CD2 (CD2 molecule)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 914
Gene name CD2 molecule
Gene symbol CD2
Synonyms (NCBI Gene)
LFA-2SRBCT11
Chromosome 1
Chromosome location 1p13.1
Summary The protein encoded by this gene is a surface antigen found on all peripheral blood T-cells. The encoded protein interacts with LFA3 (CD58) on antigen presenting cells to optimize immune recognition. A locus control region (LCR) has been found in the 3` f
miRNA miRNA information provided by mirtarbase database.
6
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (6)
miRTarBase ID miRNA Experiments Reference
MIRT874148 hsa-miR-3664-3p CLIP-seq
MIRT874149 hsa-miR-3689d CLIP-seq
MIRT874150 hsa-miR-4433 CLIP-seq
MIRT874151 hsa-miR-4459 CLIP-seq
MIRT874152 hsa-miR-4504 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (4)
Transcription factor Regulation Reference
BATF Unknown 22592317
TCFL5 Repression 12923186
USF1 Activation 7929376
USF2 Activation 7929376
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (41)
GO ID Ontology Definition Evidence Reference
GO:0001766 Process Membrane raft polarization TAS 11376005, 11591762
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IPI 17344209
GO:0005515 Function Protein binding IPI 1970422, 7544493, 9843987, 10380930, 12356317, 15105431, 16000308, 17020880, 23006327, 23663663
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
186990 1639 ENSG00000116824
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P06729
Protein name T-cell surface antigen CD2 (Erythrocyte receptor) (LFA-2) (LFA-3 receptor) (Rosette receptor) (T-cell surface antigen T11/Leu-5) (CD antigen CD2)
Protein function CD2 interacts with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling
PDB 1CDB , 1GYA , 1HNF , 1L2Z , 1QA9 , 2J6O , 2J7I
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 28 → 127 Immunoglobulin V-set domain Domain
PF05790 C2-set 135 → 205 Immunoglobulin C2-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in natural killer cells (at protein level). {ECO:0000269|PubMed:23006327}.
Sequence 
MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWE
KTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEK
IFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQ
RSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPP
GHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
Sequence length 351
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cell adhesion molecules
Hematopoietic cell lineage 		  Cell surface interactions at the vascular wall
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs864622018 RCV000206020
Show/Hide Text Mining Associations (106)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute erythroleukemia Associate 18061959
Adenomatous Polyposis Coli Associate 38073344
Alopecia Areata Inhibit 31558844
Anemia Refractory with Excess of Blasts Associate 20662087
Angina Pectoris Inhibit 26823790
Anorexia Nervosa Inhibit 10564557
Arthritis Psoriatic Associate 16741508
Arthritis Rheumatoid Associate 19898481, 23261300, 36311761
Ataxia Telangiectasia Associate 2456698
Atherosclerosis Associate 32229536