Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9136
Gene name Gene Name - the full gene name approved by the HGNC.
Ribosomal RNA processing 9, U3 small nucleolar RNA binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RRP9
Synonyms (NCBI Gene) Gene synonyms aliases
RNU3IP2, U3-55K
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the WD-repeat protein family. The encoded protein is a component of the nucleolar small nuclear ribonucleoprotein particle (snoRNP) and is essential for 18s rRNA processing during ribosome synthesis. It contains seven WD doma
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031955 hsa-miR-16-5p Proteomics 18668040
MIRT049238 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005515 Function Protein binding IPI 26867678
GO:0005654 Component Nucleoplasm TAS
GO:0005730 Component Nucleolus IDA 9418896, 26867678
GO:0006364 Process RRNA processing IC 9418896
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
620013 16829 ENSG00000114767
Protein
UniProt ID O43818
Protein name U3 small nucleolar RNA-interacting protein 2 (RRP9 homolog) (U3 small nucleolar ribonucleoprotein-associated 55 kDa protein) (U3 snoRNP-associated 55 kDa protein) (U3-55K)
Protein function Component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA (pre-rRNA) (PubMed:26867678). Part of the small subunit (SSU) processome, first precursor o
PDB 4J0W , 4JXM , 7MQ8 , 7MQ9 , 7MQA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 137 174 WD domain, G-beta repeat Repeat
PF00400 WD40 191 227 WD domain, G-beta repeat Repeat
PF00400 WD40 231 269 WD domain, G-beta repeat Repeat
PF00400 WD40 273 311 WD domain, G-beta repeat Repeat
PF00400 WD40 314 350 WD domain, G-beta repeat Repeat
Sequence
MSATAAARKRGKPASGAGAGAGAGKRRRKADSAGDRGKSKGGGKMNEEISSDSESESLAP
RKPEEEEEEELEETAQEKKLRLAKLYLEQLRQQEEEKAEARAFEEDQVAGRLKEDVLEQR
GRLQKLVAKEIQAPASADIRVLRGHQLSITCLVVTPDDSAIFSAAKDCSIIKWSVESGRK
LHVIPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGH
RDAVSGLAFRRGTHQLYSTSHDRSVKVWN
VAENSYVETLFGHQDAVAALDALSRECCVTA
GGRDGTVRVWK
IPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPLAL
QREAHGLRGEPGLEQPFWISSVAALLNTDLVATGSHSSCVRLWQCGEGFRQLDLLCDIPL
VGFINSLKFSSSGDFLVAGVGQEHRLGRWWRIKEARNSVCIIPLRRVPVPPAAGS
Sequence length 475
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Major pathway of rRNA processing in the nucleolus and cytosol
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)
21364753
Associations from Text Mining
Disease Name Relationship Type References
Colorectal Neoplasms Associate 37904456, 37988222
Inflammation Associate 37988222
Keloid Associate 37988222
Scleroderma Systemic Associate 37988222