RRP9 (ribosomal RNA processing 9, U3 small nucleolar RNA binding protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9136
Gene name Gene Name - the full gene name approved by the HGNC.
Ribosomal RNA processing 9, U3 small nucleolar RNA binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RRP9
Synonyms (NCBI Gene) Gene synonyms aliases
RNU3IP2, U3-55K
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the WD-repeat protein family. The encoded protein is a component of the nucleolar small nuclear ribonucleoprotein particle (snoRNP) and is essential for 18s rRNA processing during ribosome synthesis. It contains seven WD doma
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT031955 hsa-miR-16-5p Proteomics 18668040
MIRT049238 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(19)
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 26867678, 30021884, 33961781
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
620013 16829 ENSG00000114767
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID O43818
Protein name U3 small nucleolar RNA-interacting protein 2 (RRP9 homolog) (U3 small nucleolar ribonucleoprotein-associated 55 kDa protein) (U3 snoRNP-associated 55 kDa protein) (U3-55K)
Protein function Component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA (pre-rRNA) (PubMed:26867678). Part of the small subunit (SSU) processome, first precursor o
PDB 4J0W , 4JXM , 7MQ8 , 7MQ9 , 7MQA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 137 → 174 WD domain, G-beta repeat Repeat
PF00400 WD40 191 → 227 WD domain, G-beta repeat Repeat
PF00400 WD40 231 → 269 WD domain, G-beta repeat Repeat
PF00400 WD40 273 → 311 WD domain, G-beta repeat Repeat
PF00400 WD40 314 → 350 WD domain, G-beta repeat Repeat
Sequence 
MSATAAARKRGKPASGAGAGAGAGKRRRKADSAGDRGKSKGGGKMNEEISSDSESESLAP
RKPEEEEEEELEETAQEKKLRLAKLYLEQLRQQEEEKAEARAFEEDQVAGRLKEDVLEQR
GRLQKLVAKEIQAPASADIRVLRGHQLSITCLVVTPDDSAIFSAAKDCSIIKWSVESGRK
LHVIPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGH
RDAVSGLAFRRGTHQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTA
GGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPLAL
QREAHGLRGEPGLEQPFWISSVAALLNTDLVATGSHSSCVRLWQCGEGFRQLDLLCDIPL
VGFINSLKFSSSGDFLVAGVGQEHRLGRWWRIKEARNSVCIIPLRRVPVPPAAGS
Sequence length 475
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Major pathway of rRNA processing in the nucleolus and cytosol
<