Gene Gene information from NCBI Gene database.
Entrez ID 9136
Gene name Ribosomal RNA processing 9, U3 small nucleolar RNA binding protein
Gene symbol RRP9
Synonyms (NCBI Gene)
RNU3IP2U3-55K
Chromosome 3
Chromosome location 3p21.2
Summary This gene encodes a member of the WD-repeat protein family. The encoded protein is a component of the nucleolar small nuclear ribonucleoprotein particle (snoRNP) and is essential for 18s rRNA processing during ribosome synthesis. It contains seven WD doma
miRNA miRNA information provided by mirtarbase database.
2
miRTarBase ID miRNA Experiments Reference
MIRT031955 hsa-miR-16-5p Proteomics 18668040
MIRT049238 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 26867678, 30021884, 33961781
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620013 16829 ENSG00000114767
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43818
Protein name U3 small nucleolar RNA-interacting protein 2 (RRP9 homolog) (U3 small nucleolar ribonucleoprotein-associated 55 kDa protein) (U3 snoRNP-associated 55 kDa protein) (U3-55K)
Protein function Component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA (pre-rRNA) (PubMed:26867678). Part of the small subunit (SSU) processome, first precursor o
PDB 4J0W , 4JXM , 7MQ8 , 7MQ9 , 7MQA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 137 174 WD domain, G-beta repeat Repeat
PF00400 WD40 191 227 WD domain, G-beta repeat Repeat
PF00400 WD40 231 269 WD domain, G-beta repeat Repeat
PF00400 WD40 273 311 WD domain, G-beta repeat Repeat
PF00400 WD40 314 350 WD domain, G-beta repeat Repeat
Sequence
MSATAAARKRGKPASGAGAGAGAGKRRRKADSAGDRGKSKGGGKMNEEISSDSESESLAP
RKPEEEEEEELEETAQEKKLRLAKLYLEQLRQQEEEKAEARAFEEDQVAGRLKEDVLEQR
GRLQKLVAKEIQAPASADIRVLRGHQLSITCLVVTPDDSAIFSAAKDCSIIKWSVESGRK
LHVIPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQHLYTFTGH
RDAVSGLAFRRGTHQLYSTSHDRSVKVWN
VAENSYVETLFGHQDAVAALDALSRECCVTA
GGRDGTVRVWK
IPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPLAL
QREAHGLRGEPGLEQPFWISSVAALLNTDLVATGSHSSCVRLWQCGEGFRQLDLLCDIPL
VGFINSLKFSSSGDFLVAGVGQEHRLGRWWRIKEARNSVCIIPLRRVPVPPAAGS
Sequence length 475
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Major pathway of rRNA processing in the nucleolus and cytosol