Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9133
Gene name	Cyclin B2
Gene symbol	CCNB2
Synonyms (NCBI Gene)	HsT17299
Chromosome	15
Chromosome location	15q22.2
Summary	Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyc

Show/Hide all (37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052637	hsa-let-7a-5p	CLASH	23622248
MIRT051889	hsa-let-7b-5p	CLASH	23622248
MIRT051889	hsa-let-7b-5p	CLASH	23622248
MIRT051866	hsa-let-7c-5p	CLASH	23622248
MIRT051400	hsa-let-7f-5p	CLASH	23622248
MIRT046347	hsa-miR-23b-3p	CLASH	23622248
MIRT736557	hsa-miR-335-5p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32636645
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
EP300	Unknown	12482752
TP53	Repression	12889596

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	15232106, 17408621, 23455922, 24358021, 28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007057	Process	Spindle assembly involved in female meiosis I	IEA
GO:0008315	Process	G2/MI transition of meiotic cell cycle	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048538	Process	Thymus development	IEA
GO:0051301	Process	Cell division	IEA

MIM	HGNC	e!Ensembl
602755	1580	ENSG00000157456

O95067

Protein name

G2/mitotic-specific cyclin-B2

Protein function

Essential for the control of the cell cycle at the G2/M (mitosis) transition.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	137 → 262	Cyclin, N-terminal domain	Domain
PF02984	Cyclin_C	264 → 382	Cyclin, C-terminal domain	Domain

Sequence

MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPV
QPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDI
DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
FIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle Oocyte meiosis p53 signaling pathway Cellular senescence Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection Human immunodeficiency virus 1 infection		Polo-like kinase mediated events Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Activation of NIMA Kinases NEK9, NEK6, NEK7 Initiation of Nuclear Envelope (NE) Reformation Nuclear Pore Complex (NPC) Disassembly Cyclin A/B1/B2 associated events during G2/M transition G2/M DNA replication checkpoint The role of GTSE1 in G2/M progression after G2 checkpoint

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs35033821	RCV005903811
Cervical cancer	Benign	rs35033821	RCV005903815
Clear cell carcinoma of kidney	Benign	rs35033821	RCV005903816
Colorectal cancer	Benign	rs35033821	RCV005903819
Gastric cancer	Benign	rs35033821	RCV005903821
Hepatocellular carcinoma	Benign	rs35033821	RCV005903812
Lung cancer	Benign	rs35033821	RCV005903827
Malignant lymphoma, large B-cell, diffuse	Benign	rs35033821	RCV005903818
Malignant tumor of esophagus	Benign	rs35033821	RCV005903813
Melanoma	Benign	rs35033821	RCV005903826
Nonpapillary renal cell carcinoma	Benign	rs35033821	RCV005903814
Ovarian serous cystadenocarcinoma	Benign	rs35033821	RCV005903822
Sarcoma	Benign	rs35033821	RCV005903820
Thymoma	Benign	rs35033821	RCV005903824
Thyroid cancer, nonmedullary, 1	Benign	rs35033821	RCV005903825
Uterine carcinosarcoma	Uncertain significance; Benign	rs148986291, rs35033821	RCV005929169 RCV005903823
Uterine corpus endometrial carcinoma	Benign	rs35033821	RCV005903828
Uveal melanoma	Benign	rs35033821	RCV005903817

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma Follicular	Associate	32093341
Adenocarcinoma of Lung	Associate	17549666, 23874428, 24375198, 27610375, 29870138, 31698633, 33126397, 33187219, 34039308, 34446056, 35354488
Adrenocortical Carcinoma	Associate	32147961, 32287321, 35185794
Azoospermia	Associate	35219767
Breast Neoplasms	Associate	23282137, 32705365, 33285689, 35456460, 36930083, 39206892
Carcinogenesis	Associate	21338529
Carcinoma Adenoid Cystic	Associate	31914060
Carcinoma Basal Cell	Associate	29967001
Carcinoma Endometrioid	Associate	29967001
Carcinoma Hepatocellular	Associate	29728556, 30272310, 30341252, 30720105, 31043166, 31746405, 31811111, 32627011, 32685486, 32722976, 32863381, 33111935, 33157984, 34315286, 34337056 View all (4 more)
Carcinoma Hepatocellular	Stimulate	30228980
Carcinoma Non Small Cell Lung	Associate	21965272, 24375198, 34825846
Carcinoma Pancreatic Ductal	Stimulate	35068444
Carcinoma Renal Cell	Associate	30822312, 34716619, 35339898, 38300330
Carcinoma Squamous Cell	Associate	33477943, 36714024, 37442189
Chromosome Aberrations	Associate	34193281
Colorectal Neoplasms	Associate	26040697
COVID 19	Associate	36856850, 37278873
Diabetes Gestational	Associate	30474315
Dissection Thoracic Aorta	Associate	31751374
Fibrosis	Associate	31811111
Glioblastoma	Associate	32696617, 39528802
Glioma	Associate	30405856, 30995921, 32696617, 34908101, 35774141
Glioma	Stimulate	35676807
Leiomyosarcoma	Associate	25748237
Leukemia Myeloid Acute	Associate	31844417
Lung Neoplasms	Associate	24375198, 36714024, 39331864
Lymphoma Non Hodgkin	Associate	29967001
Lymphoma Non Hodgkin	Stimulate	34908101
Mesothelioma Malignant	Associate	33032291
Multiple Myeloma	Associate	23522059
Nasopharyngeal Carcinoma	Associate	35509856, 38166895
Neoplasm Metastasis	Associate	38166895
Neoplasms	Associate	17549666, 24553122, 28052097, 32685486, 34315286, 34446056, 34908101, 35839486, 38300330
Neoplasms	Stimulate	21338529, 24375198, 32863381, 35676807
Ovarian Neoplasms	Associate	19738611, 31987036
Primary cortisol resistance	Associate	32287321
Prostatic Neoplasms	Associate	29233929, 34198380, 34497666, 36834602, 37682152
Prostatic Neoplasms Castration Resistant	Associate	28901445
Respiratory Distress Syndrome	Associate	27090785
Retinoblastoma	Associate	33217867
Sepsis	Associate	27090785
Sertoli Cell Only Syndrome	Associate	37500704
Silicosis	Associate	37278873
Small Cell Lung Carcinoma	Stimulate	34825846
Spinal Cord Injuries	Associate	31783707
Squamous Cell Carcinoma of Head and Neck	Associate	26912061, 36768994, 36820589
Stomach Neoplasms	Associate	25743799, 27983933
Thyroid Carcinoma Anaplastic	Associate	33455115
Tracheal Stenosis	Associate	32309912
Triple Negative Breast Neoplasms	Stimulate	39206892
Trisomy 18 Syndrome	Associate	34193281
Urinary Bladder Neoplasms	Associate	36820589
Uterine Cervical Dysplasia	Associate	35008799
Uterine Cervical Neoplasms	Associate	21338529, 23405241

CCNB2 (cyclin B2)