Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9133
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin B2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCNB2
Synonyms (NCBI Gene) Gene synonyms aliases	HsT17299
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyc

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052637	hsa-let-7a-5p	CLASH	23622248
MIRT051889	hsa-let-7b-5p	CLASH	23622248
MIRT051889	hsa-let-7b-5p	CLASH	23622248
MIRT051866	hsa-let-7c-5p	CLASH	23622248
MIRT051400	hsa-let-7f-5p	CLASH	23622248
MIRT046347	hsa-miR-23b-3p	CLASH	23622248
MIRT736557	hsa-miR-335-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	32636645
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT871247	hsa-miR-3168	CLIP-seq
MIRT871248	hsa-miR-335	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT871249	hsa-miR-433	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq
MIRT871250	hsa-miR-4759	CLIP-seq
MIRT871251	hsa-miR-4799-5p	CLIP-seq
MIRT1958675	hsa-miR-1253	CLIP-seq
MIRT1958676	hsa-miR-3663-5p	CLIP-seq
MIRT1958677	hsa-miR-4251	CLIP-seq
MIRT1958678	hsa-miR-4329	CLIP-seq
MIRT1958679	hsa-miR-4527	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
EP300	Unknown	12482752
TP53	Repression	12889596

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	15232106, 17408621, 23455922, 24358021, 28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0007057	Process	Spindle assembly involved in female meiosis I	IEA
GO:0008315	Process	G2/MI transition of meiotic cell cycle	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048538	Process	Thymus development	IEA
GO:0051301	Process	Cell division	IEA

MIM	HGNC	e!Ensembl
602755	1580	ENSG00000157456

Protein

UniProt ID

O95067

Protein name

G2/mitotic-specific cyclin-B2

Protein function

Essential for the control of the cell cycle at the G2/M (mitosis) transition.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	137 → 262	Cyclin, N-terminal domain	Domain
PF02984	Cyclin_C	264 → 382	Cyclin, C-terminal domain	Domain

Sequence

MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPV
QPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDI
DNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTK
FIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle Oocyte meiosis p53 signaling pathway Cellular senescence Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection Human immunodeficiency virus 1 infection		Polo-like kinase mediated events Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Activation of NIMA Kinases NEK9, NEK6, NEK7 Initiation of Nuclear Envelope (NE) Reformation Nuclear Pore Complex (NPC) Disassembly Cyclin A/B1/B2 associated events during G2/M transition G2/M DNA replication checkpoint The role of GTSE1 in G2/M progression after G2 checkpoint

CCNB2 (cyclin B2)