Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9123
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 16 member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC16A3
Synonyms (NCBI Gene) Gene synonyms aliases	MCT 3, MCT 4, MCT-3, MCT-4, MCT3, MCT4
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family-16. Each MCT appears to have slightly different substrate and

Show/Hide all(52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001416	hsa-miR-16-5p	pSILAC	18668040
MIRT027668	hsa-miR-98-5p	Microarray	19088304
MIRT001416	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT1353058	hsa-miR-1	CLIP-seq
MIRT1353059	hsa-miR-1276	CLIP-seq
MIRT1353060	hsa-miR-1299	CLIP-seq
MIRT1353061	hsa-miR-141	CLIP-seq
MIRT1353062	hsa-miR-200a	CLIP-seq
MIRT1353063	hsa-miR-206	CLIP-seq
MIRT1353064	hsa-miR-3180-5p	CLIP-seq
MIRT1353065	hsa-miR-3673	CLIP-seq
MIRT1353066	hsa-miR-3978	CLIP-seq
MIRT1353067	hsa-miR-425	CLIP-seq
MIRT1353068	hsa-miR-4462	CLIP-seq
MIRT1353069	hsa-miR-4651	CLIP-seq
MIRT1353070	hsa-miR-4685-5p	CLIP-seq
MIRT1353071	hsa-miR-587	CLIP-seq
MIRT1353072	hsa-miR-608	CLIP-seq
MIRT1353073	hsa-miR-613	CLIP-seq
MIRT1353074	hsa-miR-629	CLIP-seq
MIRT1353075	hsa-miR-657	CLIP-seq
MIRT1353076	hsa-miR-875-3p	CLIP-seq
MIRT2623418	hsa-miR-1224-3p	CLIP-seq
MIRT2623419	hsa-miR-1260	CLIP-seq
MIRT2623420	hsa-miR-1260b	CLIP-seq
MIRT2623421	hsa-miR-1280	CLIP-seq
MIRT2623422	hsa-miR-1323	CLIP-seq
MIRT1353061	hsa-miR-141	CLIP-seq
MIRT2623423	hsa-miR-188-3p	CLIP-seq
MIRT1353062	hsa-miR-200a	CLIP-seq
MIRT2623424	hsa-miR-3156-3p	CLIP-seq
MIRT2623425	hsa-miR-3679-3p	CLIP-seq
MIRT2623426	hsa-miR-371b-5p	CLIP-seq
MIRT2623427	hsa-miR-4258	CLIP-seq
MIRT1353068	hsa-miR-4462	CLIP-seq
MIRT2623428	hsa-miR-4750	CLIP-seq
MIRT2623429	hsa-miR-548o	CLIP-seq
MIRT2623418	hsa-miR-1224-3p	CLIP-seq
MIRT2623419	hsa-miR-1260	CLIP-seq
MIRT2623420	hsa-miR-1260b	CLIP-seq
MIRT2623421	hsa-miR-1280	CLIP-seq
MIRT2623422	hsa-miR-1323	CLIP-seq
MIRT1353061	hsa-miR-141	CLIP-seq
MIRT2623423	hsa-miR-188-3p	CLIP-seq
MIRT1353062	hsa-miR-200a	CLIP-seq
MIRT2623424	hsa-miR-3156-3p	CLIP-seq
MIRT2623425	hsa-miR-3679-3p	CLIP-seq
MIRT2623426	hsa-miR-371b-5p	CLIP-seq
MIRT2623427	hsa-miR-4258	CLIP-seq
MIRT1353068	hsa-miR-4462	CLIP-seq
MIRT2623428	hsa-miR-4750	CLIP-seq
MIRT2623429	hsa-miR-548o	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	10921872, 25416956, 30126976, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10921872, 28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9425115
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	IEA
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	TAS	9425115
GO:0015129	Function	Lactate transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015650	Function	Lactate:proton symporter activity	IBA
GO:0015650	Function	Lactate:proton symporter activity	IDA	11101640
GO:0015650	Function	Lactate:proton symporter activity	IEA
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0015718	Process	Monocarboxylic acid transport	TAS	9425115
GO:0015727	Process	Lactate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9425115
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IDA	21199217, 31791063
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	31791063
GO:0016328	Component	Lateral plasma membrane	IDA	26854723
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0035873	Process	Lactate transmembrane transport	IDA	11101640
GO:0035879	Process	Plasma membrane lactate transport	IEA
GO:0042867	Process	Pyruvate catabolic process	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0050833	Function	Pyruvate transmembrane transporter activity	IDA	31719150
GO:0055085	Process	Transmembrane transport	IEA
GO:1901475	Process	Pyruvate transmembrane transport	IDA	31719150

MIM	HGNC	e!Ensembl
603877	10924	ENSG00000141526

Protein

UniProt ID

O15427

Protein name

Monocarboxylate transporter 4 (MCT 4) (Solute carrier family 16 member 3)

Protein function

Proton-dependent transporter of monocarboxylates such as L-lactate and pyruvate (PubMed:11101640, PubMed:23935841, PubMed:31719150). Plays a predominant role in L-lactate efflux from highly glycolytic cells (By similarity). {ECO:0000250|UniProtK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	25 → 371	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal muscle. {ECO:0000269|PubMed:9425115}.

Sequence

MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDT
AWISSILLAMLYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGV
ITGLGLALNFQPSLIMLNRYFSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGF
LILGGLLLNCCVCAALMRPLVVTAQPGSGPPRPSRRLLDLSVFRDRGFVLYAVAASVMVL
GLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPAAGFVAGLGKVRPYSVYLFSF
SMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTHKFSSAIGLVL
LMEAVAVLVGPPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE
VAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV

Sequence length

465

Interactions

View interactions

	KEGG		Reactome
	Central carbon metabolism in cancer		Basigin interactions Proton-coupled monocarboxylate transport Pyruvate metabolism

SLC16A3 (solute carrier family 16 member 3)