Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	9123
Gene name	Solute carrier family 16 member 3
Gene symbol	SLC16A3
Synonyms (NCBI Gene)	MCT 3MCT 4MCT-3MCT-4MCT3MCT4
Chromosome	17
Chromosome location	17q25.3
Summary	Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family-16. Each MCT appears to have slightly different substrate and

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001416	hsa-miR-16-5p	pSILAC	18668040
MIRT027668	hsa-miR-98-5p	Microarray	19088304
MIRT001416	hsa-miR-16-5p	Proteomics;Other	18668040
MIRT1353058	hsa-miR-1	CLIP-seq
MIRT1353059	hsa-miR-1276	CLIP-seq
MIRT1353060	hsa-miR-1299	CLIP-seq
MIRT1353061	hsa-miR-141	CLIP-seq
MIRT1353062	hsa-miR-200a	CLIP-seq
MIRT1353063	hsa-miR-206	CLIP-seq
MIRT1353064	hsa-miR-3180-5p	CLIP-seq
MIRT1353065	hsa-miR-3673	CLIP-seq
MIRT1353066	hsa-miR-3978	CLIP-seq
MIRT1353067	hsa-miR-425	CLIP-seq
MIRT1353068	hsa-miR-4462	CLIP-seq
MIRT1353069	hsa-miR-4651	CLIP-seq
MIRT1353070	hsa-miR-4685-5p	CLIP-seq
MIRT1353071	hsa-miR-587	CLIP-seq
MIRT1353072	hsa-miR-608	CLIP-seq
MIRT1353073	hsa-miR-613	CLIP-seq
MIRT1353074	hsa-miR-629	CLIP-seq
MIRT1353075	hsa-miR-657	CLIP-seq
MIRT1353076	hsa-miR-875-3p	CLIP-seq
MIRT2623418	hsa-miR-1224-3p	CLIP-seq
MIRT2623419	hsa-miR-1260	CLIP-seq
MIRT2623420	hsa-miR-1260b	CLIP-seq
MIRT2623421	hsa-miR-1280	CLIP-seq
MIRT2623422	hsa-miR-1323	CLIP-seq
MIRT1353061	hsa-miR-141	CLIP-seq
MIRT2623423	hsa-miR-188-3p	CLIP-seq
MIRT1353062	hsa-miR-200a	CLIP-seq
MIRT2623424	hsa-miR-3156-3p	CLIP-seq
MIRT2623425	hsa-miR-3679-3p	CLIP-seq
MIRT2623426	hsa-miR-371b-5p	CLIP-seq
MIRT2623427	hsa-miR-4258	CLIP-seq
MIRT1353068	hsa-miR-4462	CLIP-seq
MIRT2623428	hsa-miR-4750	CLIP-seq
MIRT2623429	hsa-miR-548o	CLIP-seq
MIRT2623418	hsa-miR-1224-3p	CLIP-seq
MIRT2623419	hsa-miR-1260	CLIP-seq
MIRT2623420	hsa-miR-1260b	CLIP-seq
MIRT2623421	hsa-miR-1280	CLIP-seq
MIRT2623422	hsa-miR-1323	CLIP-seq
MIRT1353061	hsa-miR-141	CLIP-seq
MIRT2623423	hsa-miR-188-3p	CLIP-seq
MIRT1353062	hsa-miR-200a	CLIP-seq
MIRT2623424	hsa-miR-3156-3p	CLIP-seq
MIRT2623425	hsa-miR-3679-3p	CLIP-seq
MIRT2623426	hsa-miR-371b-5p	CLIP-seq
MIRT2623427	hsa-miR-4258	CLIP-seq
MIRT1353068	hsa-miR-4462	CLIP-seq
MIRT2623428	hsa-miR-4750	CLIP-seq
MIRT2623429	hsa-miR-548o	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	10921872, 25416956, 30126976, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10921872, 28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9425115
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	IEA
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	TAS	9425115
GO:0015129	Function	Lactate transmembrane transporter activity	IEA
GO:0015293	Function	Symporter activity	IEA
GO:0015650	Function	Lactate:proton symporter activity	IBA
GO:0015650	Function	Lactate:proton symporter activity	IDA	11101640
GO:0015650	Function	Lactate:proton symporter activity	IEA
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0015718	Process	Monocarboxylic acid transport	TAS	9425115
GO:0015727	Process	Lactate transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9425115
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IDA	21199217, 31791063
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	31791063
GO:0016328	Component	Lateral plasma membrane	IDA	26854723
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0035873	Process	Lactate transmembrane transport	IDA	11101640
GO:0035879	Process	Plasma membrane lactate transport	IEA
GO:0042867	Process	Pyruvate catabolic process	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0050833	Function	Pyruvate transmembrane transporter activity	IDA	31719150
GO:0055085	Process	Transmembrane transport	IEA
GO:1901475	Process	Pyruvate transmembrane transport	IDA	31719150

MIM	HGNC	e!Ensembl
603877	10924	ENSG00000141526

O15427

Protein name

Monocarboxylate transporter 4 (MCT 4) (Solute carrier family 16 member 3)

Protein function

Proton-dependent transporter of monocarboxylates such as L-lactate and pyruvate (PubMed:11101640, PubMed:23935841, PubMed:31719150). Plays a predominant role in L-lactate efflux from highly glycolytic cells (By similarity). {ECO:0000250|UniProtK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	25 → 371	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal muscle. {ECO:0000269|PubMed:9425115}.

Sequence

MGGAVVDEGPTGVKAPDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDT
AWISSILLAMLYGTGPLCSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGV
ITGLGLALNFQPSLIMLNRYFSKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGF
LILGGLLLNCCVCAALMRPLVVTAQPGSGPPRPSRRLLDLSVFRDRGFVLYAVAASVMVL
GLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPAAGFVAGLGKVRPYSVYLFSF
SMFFNGLADLAGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTHKFSSAIGLVL
LMEAVAVLVGPPSGGKLLDATHVYMYVFILAGAEVLTSSLILLLGNFFCIRKKPKEPQPE
VAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV

Sequence length

465

Interactions

View interactions

	KEGG		Reactome
	Central carbon metabolism in cancer		Basigin interactions Proton-coupled monocarboxylate transport Pyruvate metabolism

SLC16A3 (solute carrier family 16 member 3)