Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	912
Gene name	CD1d molecule
Gene symbol	CD1D
Synonyms (NCBI Gene)	CD1AR3R3G1
Chromosome	1
Chromosome location	1q23.1
Summary	This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the pres

204

Show/Hide all (204)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019031	hsa-miR-335-5p	Microarray	18185580
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646057	hsa-miR-3714	HITS-CLIP	23824327
MIRT646056	hsa-miR-3910	HITS-CLIP	23824327
MIRT646055	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646053	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT646052	hsa-miR-4477b	HITS-CLIP	23824327
MIRT646051	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646057	hsa-miR-3714	HITS-CLIP	23824327
MIRT646056	hsa-miR-3910	HITS-CLIP	23824327
MIRT646055	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646053	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT646052	hsa-miR-4477b	HITS-CLIP	23824327
MIRT646051	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT528774	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT528773	hsa-miR-3929	PAR-CLIP	22012620
MIRT528772	hsa-miR-4419b	PAR-CLIP	22012620
MIRT528771	hsa-miR-4478	PAR-CLIP	22012620
MIRT528770	hsa-miR-1182	PAR-CLIP	22012620
MIRT528769	hsa-miR-4781-3p	PAR-CLIP	22012620
MIRT528768	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT528767	hsa-miR-4524a-3p	PAR-CLIP	22012620
MIRT528766	hsa-miR-6832-5p	PAR-CLIP	22012620
MIRT528765	hsa-miR-4732-5p	PAR-CLIP	22012620
MIRT528764	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT528763	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT528762	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT528761	hsa-miR-3674	PAR-CLIP	22012620
MIRT446001	hsa-miR-548ac	PAR-CLIP	22100165
MIRT446002	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT446000	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445999	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445998	hsa-miR-548z	PAR-CLIP	22100165
MIRT445997	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445996	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445995	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445994	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445993	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445992	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445991	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445990	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445989	hsa-miR-5702	PAR-CLIP	22100165
MIRT445988	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445987	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445986	hsa-miR-8081	PAR-CLIP	22100165
MIRT446001	hsa-miR-548ac	PAR-CLIP	22100165
MIRT446002	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT446000	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445999	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445998	hsa-miR-548z	PAR-CLIP	22100165
MIRT445997	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445996	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445995	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445994	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445993	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445992	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445991	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445990	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445989	hsa-miR-5702	PAR-CLIP	22100165
MIRT445988	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445987	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445986	hsa-miR-8081	PAR-CLIP	22100165
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646057	hsa-miR-3714	HITS-CLIP	23824327
MIRT646056	hsa-miR-3910	HITS-CLIP	23824327
MIRT646055	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646053	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT646052	hsa-miR-4477b	HITS-CLIP	23824327
MIRT646051	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646057	hsa-miR-3714	HITS-CLIP	23824327
MIRT646056	hsa-miR-3910	HITS-CLIP	23824327
MIRT646055	hsa-miR-3120-3p	HITS-CLIP	23824327
MIRT646054	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT646053	hsa-miR-506-3p	HITS-CLIP	23824327
MIRT646052	hsa-miR-4477b	HITS-CLIP	23824327
MIRT646051	hsa-miR-7856-5p	HITS-CLIP	23824327
MIRT528774	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT528773	hsa-miR-3929	PAR-CLIP	22012620
MIRT528772	hsa-miR-4419b	PAR-CLIP	22012620
MIRT528771	hsa-miR-4478	PAR-CLIP	22012620
MIRT528770	hsa-miR-1182	PAR-CLIP	22012620
MIRT528769	hsa-miR-4781-3p	PAR-CLIP	22012620
MIRT528768	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT528767	hsa-miR-4524a-3p	PAR-CLIP	22012620
MIRT528766	hsa-miR-6832-5p	PAR-CLIP	22012620
MIRT528765	hsa-miR-4732-5p	PAR-CLIP	22012620
MIRT528764	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT528763	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT528762	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT528761	hsa-miR-3674	PAR-CLIP	22012620
MIRT446001	hsa-miR-548ac	PAR-CLIP	22100165
MIRT446002	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT446000	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445999	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445998	hsa-miR-548z	PAR-CLIP	22100165
MIRT445997	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445996	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445995	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445994	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445993	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445992	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445991	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445990	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445989	hsa-miR-5702	PAR-CLIP	22100165
MIRT445988	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445987	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445986	hsa-miR-8081	PAR-CLIP	22100165
MIRT446001	hsa-miR-548ac	PAR-CLIP	22100165
MIRT446002	hsa-miR-548bb-3p	PAR-CLIP	22100165
MIRT446000	hsa-miR-548d-3p	PAR-CLIP	22100165
MIRT445999	hsa-miR-548h-3p	PAR-CLIP	22100165
MIRT445998	hsa-miR-548z	PAR-CLIP	22100165
MIRT445997	hsa-miR-548ae-3p	PAR-CLIP	22100165
MIRT445996	hsa-miR-548ah-3p	PAR-CLIP	22100165
MIRT445995	hsa-miR-548aj-3p	PAR-CLIP	22100165
MIRT445994	hsa-miR-548am-3p	PAR-CLIP	22100165
MIRT445993	hsa-miR-548aq-3p	PAR-CLIP	22100165
MIRT445992	hsa-miR-548j-3p	PAR-CLIP	22100165
MIRT445991	hsa-miR-548x-3p	PAR-CLIP	22100165
MIRT445990	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT445989	hsa-miR-5702	PAR-CLIP	22100165
MIRT445988	hsa-miR-937-5p	PAR-CLIP	22100165
MIRT445987	hsa-miR-627-5p	PAR-CLIP	22100165
MIRT445986	hsa-miR-8081	PAR-CLIP	22100165
MIRT874029	hsa-miR-1197	CLIP-seq
MIRT874030	hsa-miR-145	CLIP-seq
MIRT874031	hsa-miR-3652	CLIP-seq
MIRT874032	hsa-miR-378g	CLIP-seq
MIRT874033	hsa-miR-4430	CLIP-seq
MIRT874034	hsa-miR-4505	CLIP-seq
MIRT874035	hsa-miR-4511	CLIP-seq
MIRT874036	hsa-miR-548b-3p	CLIP-seq
MIRT1921945	hsa-miR-377	CLIP-seq
MIRT1921946	hsa-miR-603	CLIP-seq
MIRT1959204	hsa-miR-1305	CLIP-seq
MIRT1959205	hsa-miR-1915	CLIP-seq
MIRT1959206	hsa-miR-2467-5p	CLIP-seq
MIRT1959207	hsa-miR-3188	CLIP-seq
MIRT1959208	hsa-miR-370	CLIP-seq
MIRT1959209	hsa-miR-3975	CLIP-seq
MIRT1959210	hsa-miR-421	CLIP-seq
MIRT1959211	hsa-miR-4496	CLIP-seq
MIRT1959212	hsa-miR-4649-3p	CLIP-seq
MIRT1959213	hsa-miR-4663	CLIP-seq
MIRT1959214	hsa-miR-4687-3p	CLIP-seq
MIRT1959215	hsa-miR-4726-3p	CLIP-seq
MIRT1959216	hsa-miR-4803	CLIP-seq
MIRT1959217	hsa-miR-485-5p	CLIP-seq
MIRT2196192	hsa-miR-1183	CLIP-seq
MIRT2196193	hsa-miR-1224-3p	CLIP-seq
MIRT2196194	hsa-miR-1260	CLIP-seq
MIRT2196195	hsa-miR-1260b	CLIP-seq
MIRT2196196	hsa-miR-1280	CLIP-seq
MIRT1959204	hsa-miR-1305	CLIP-seq
MIRT2196197	hsa-miR-142-3p	CLIP-seq
MIRT1959205	hsa-miR-1915	CLIP-seq
MIRT2196198	hsa-miR-2117	CLIP-seq
MIRT1959206	hsa-miR-2467-5p	CLIP-seq
MIRT2196199	hsa-miR-3180-5p	CLIP-seq
MIRT1959207	hsa-miR-3188	CLIP-seq
MIRT2196200	hsa-miR-369-3p	CLIP-seq
MIRT1959208	hsa-miR-370	CLIP-seq
MIRT2196201	hsa-miR-374c	CLIP-seq
MIRT1959209	hsa-miR-3975	CLIP-seq
MIRT1959210	hsa-miR-421	CLIP-seq
MIRT2196202	hsa-miR-4269	CLIP-seq
MIRT2196203	hsa-miR-4273	CLIP-seq
MIRT2196204	hsa-miR-4514	CLIP-seq
MIRT2196205	hsa-miR-4643	CLIP-seq
MIRT1959212	hsa-miR-4649-3p	CLIP-seq
MIRT2196206	hsa-miR-466	CLIP-seq
MIRT1959213	hsa-miR-4663	CLIP-seq
MIRT2196207	hsa-miR-4668-3p	CLIP-seq
MIRT2196208	hsa-miR-4684-5p	CLIP-seq
MIRT1959214	hsa-miR-4687-3p	CLIP-seq
MIRT2196209	hsa-miR-4692	CLIP-seq
MIRT2196210	hsa-miR-4705	CLIP-seq
MIRT2196211	hsa-miR-4713-3p	CLIP-seq
MIRT2196212	hsa-miR-4714-3p	CLIP-seq
MIRT1959215	hsa-miR-4726-3p	CLIP-seq
MIRT2196213	hsa-miR-4742-5p	CLIP-seq
MIRT2196214	hsa-miR-4789-3p	CLIP-seq
MIRT1959216	hsa-miR-4803	CLIP-seq
MIRT1959217	hsa-miR-485-5p	CLIP-seq
MIRT2196215	hsa-miR-520a-5p	CLIP-seq
MIRT2196216	hsa-miR-525-5p	CLIP-seq
MIRT2196217	hsa-miR-532-3p	CLIP-seq
MIRT2196218	hsa-miR-642b	CLIP-seq
MIRT2196219	hsa-miR-655	CLIP-seq
MIRT2196220	hsa-miR-943	CLIP-seq
MIRT1959204	hsa-miR-1305	CLIP-seq
MIRT2196200	hsa-miR-369-3p	CLIP-seq
MIRT2196201	hsa-miR-374c	CLIP-seq
MIRT1959210	hsa-miR-421	CLIP-seq
MIRT2196205	hsa-miR-4643	CLIP-seq
MIRT2196206	hsa-miR-466	CLIP-seq
MIRT2196214	hsa-miR-4789-3p	CLIP-seq
MIRT1959216	hsa-miR-4803	CLIP-seq
MIRT2196219	hsa-miR-655	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
HDAC1	Repression	22419072
HDAC2	Repression	22419072
LEF1	Repression	20363964
LEF1	Unknown	15100293
SP1	Activation	22419072

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IBA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	30126976
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IDA	19124746
GO:0005764	Component	Lysosome	IDA	21802320
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	11315191
GO:0006955	Process	Immune response	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	19124746
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016045	Process	Detection of bacterium	TAS	14500461
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0030881	Function	Beta-2-microglobulin binding	TAS	14500461
GO:0030882	Function	Lipid antigen binding	IDA	19124746, 21802320
GO:0030883	Function	Endogenous lipid antigen binding	IBA
GO:0030884	Function	Exogenous lipid antigen binding	IBA
GO:0030884	Function	Exogenous lipid antigen binding	IDA	10523605
GO:0034113	Process	Heterotypic cell-cell adhesion	TAS	19124746
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	19124746
GO:0045058	Process	T cell selection	TAS	14500461
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	TAS	14500461
GO:0048006	Process	Antigen processing and presentation, endogenous lipid antigen via MHC class Ib	IBA
GO:0048006	Process	Antigen processing and presentation, endogenous lipid antigen via MHC class Ib	IDA	10523605
GO:0048007	Process	Antigen processing and presentation, exogenous lipid antigen via MHC class Ib	IBA
GO:0050839	Function	Cell adhesion molecule binding	IPI	19124746
GO:0071723	Function	Lipopeptide binding	IBA

MIM	HGNC	e!Ensembl
188410	1637	ENSG00000158473

P15813

Protein name

Antigen-presenting glycoprotein CD1d (R3G1) (CD antigen CD1d)

Protein function

Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.

PDB

1ZT4 , 2PO6 , 3HUJ , 3SDX , 3TZV , 3U0P , 3VWJ , 3VWK , 4EN3 , 4LHU , 4MNG , 4MQ7 , 4WO4 , 4WW2 , 4WWK , 6V7Y , 6V7Z , 6V80 , 8SGB , 8SGM , 8SOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16497	MHC_I_3	1 → 198	MHC-I family domain	Domain
PF07654	C1-set	209 → 286	Immunoglobulin C1-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.

Sequence

MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSN
DSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC
EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLL
NGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR
GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYT
SMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL

Sequence length

335

Interactions

View interactions

	KEGG		Reactome
	Tight junction Hematopoietic cell lineage Amoebiasis		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (60)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Abetalipoproteinemia	Associate	20592474	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Disease	Associate	39809189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Associate	22253809	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Associate	18385757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Associate	10840051, 15654963, 21853044	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Associate	32860660	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Associate	23372165	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	21258883, 30651076	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	15634340	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	29643189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	33593879, 33761652	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	25477528	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	26339378	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Associate	10233754	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Associate	21548449	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cytokine Release Syndrome	Stimulate	21061446	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Associate	31050367	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Associate	19592659	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	11877486	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	24513807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Stimulate	24513807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epstein Barr Virus Infections	Associate	23974196	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Inhibit	32078695	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Associate	15916690, 35886988	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	24292792	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Inhibit	15147365	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Associate	23372165	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Associate	29643189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Associate	29643189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Herpesviridae Infections	Associate	15864354	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	12519296, 16368878, 19197939, 20942750, 21198755, 26584215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	15864354	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	24513807, 26295359, 28678593	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngopharyngeal Reflux	Associate	18323539	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	31354710	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	23065503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	31354710	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	22406267, 34936686	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	27614429	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	27614429	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	36466837, 38279987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	18980990, 19056691, 38040419	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	31050367	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	30651076	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11877486, 15123743, 15654963, 19056691, 19592659, 21258883, 24292792, 25477528, 26119195, 26969612, 27614429, 30651076, 31560833, 33761652, 34530906, 38040419 View all (1 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors Primitive	Associate	26963506	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	19585513, 32184790	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Associate	35720369	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	26023084, 34389782	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	40280259	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Associate	26119195	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Associate	11290557	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polychondritis Relapsing	Inhibit	15147365	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	18385757, 19592659	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	29179729	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Associate	19592659	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	26119195	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	26708831	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Stimulate	31560833	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	31316301	★★★★★ ★☆☆☆☆ Found in Text Mining only

CD1D (CD1d molecule)