KRT75 (keratin 75)

Gene

• Entrez ID: 9119
• Gene name: Keratin 75
• Gene symbol: KRT75
• Synonyms (NCBI Gene): CK-75, K6HF, K75, KB18, PFB, hK6hf
• Chromosome: 12
• Chromosome location: 12q13.13
• Summary: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs2232387	C>T	Not-provided, risk-factor	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023996	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT1101482	hsa-miR-1321	CLIP-seq
MIRT1101483	hsa-miR-3689d	CLIP-seq
MIRT1101484	hsa-miR-4419a	CLIP-seq
MIRT1101485	hsa-miR-4510	CLIP-seq
MIRT1101486	hsa-miR-4633-3p	CLIP-seq
MIRT1101487	hsa-miR-4728-5p	CLIP-seq
MIRT1101488	hsa-miR-4739	CLIP-seq
MIRT1101489	hsa-miR-4756-5p	CLIP-seq
MIRT1101490	hsa-miR-516b	CLIP-seq
MIRT2027584	hsa-miR-1256	CLIP-seq
MIRT2027585	hsa-miR-4461	CLIP-seq
MIRT2027586	hsa-miR-4720-5p	CLIP-seq
MIRT2027587	hsa-miR-4799-3p	CLIP-seq
MIRT2027588	hsa-miR-490-3p	CLIP-seq
MIRT2027589	hsa-miR-549	CLIP-seq
MIRT2390033	hsa-miR-198	CLIP-seq
MIRT2390034	hsa-miR-3173-3p	CLIP-seq
MIRT2390035	hsa-miR-4533	CLIP-seq
MIRT2390036	hsa-miR-4725-5p	CLIP-seq
MIRT2390037	hsa-miR-4751	CLIP-seq
MIRT2390038	hsa-miR-504	CLIP-seq
MIRT2390039	hsa-miR-642b	CLIP-seq
MIRT2390040	hsa-miR-765	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0005198	Function	Structural molecule activity	TAS	9856802
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005882	Component	Intermediate filament	IDA	15086549
GO:0005882	Component	Intermediate filament	IEA
GO:0030280	Function	Structural constituent of skin epidermis	IBA
GO:0031424	Process	Keratinization	IBA
GO:0045095	Component	Keratin filament	IBA
GO:0045095	Component	Keratin filament	IEA
GO:0045109	Process	Intermediate filament organization	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 609025
• HGNC: 24431
• e!Ensembl: ENSG00000170454

Protein

• UniProt ID: O95678
• Protein name: Keratin, type II cytoskeletal 75 (Cytokeratin-75) (CK-75) (Keratin-6 hair follicle) (hK6hf) (Keratin-75) (K75) (Type II keratin-K6hf) (Type-II keratin Kb18)
• Protein function: Plays a central role in hair and nail formation. Essential component of keratin intermediate filaments in the companion layer of the hair follicle.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16208	Keratin_2_head	16 → 145	Keratin type II head	Family
  PF00038	Filament	148 → 461	Intermediate filament protein	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in hair follicles from scalp. Specifically expressed in the of the hair companion layer follicle, a single layered band of flat and vertically oriented cells between the cuboidal outer root sheath (ORS) cells and the i
• Sequence:

  MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSAGASFGSR
  SLYNLGGAKRVSINGCGSSCRSGFGGRASNRFGVNSGFGYGGGVGGGFSGPSFPVCPPGG
  IQEVTVNQSLLTPLHLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETK
  WALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVRYE
  DEINKRTAAENEFVALKKDVDAAYMNKVELEAKVKSLPEEINFIHSVFDAELSQLQTQVG
  DTSVVLSMDNNRNLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDL
  RNTKQEISEMNRMIQRLRAEIDSVKKQCSSLQTAIADAEQRGELALKDARAKLVDLEEAL
  QKAKQDMARLLREYQELMNIKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTLS
  SGYGSGSSIGGGNLGLGGGSGYSFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVS
  TTSSSQKSYTH

• Sequence length: 551

Pathways

Reactome:

Keratinization
Formation of the cornified envelope

<