Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
91147
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 67
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM67
Synonyms (NCBI Gene) Gene synonyms aliases
JBTS6, MECKELIN, MKS3, NPHP11, TNEM67
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene localizes to the primary cilium and to the plasma membrane. The gene functions in centriole migration to the apical membrane and formation of the primary cilium. Multiple transcript variants encoding different isoforms hav
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs34779331 C>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, 5 prime UTR variant, non coding transcript variant, missense variant
rs35765535 C>G Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs111619594 A>T Benign, conflicting-interpretations-of-pathogenicity, risk-factor, uncertain-significance Coding sequence variant, intron variant, missense variant, non coding transcript variant
rs111991507 A>G Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, intron variant, synonymous variant, non coding transcript variant
rs115563233 G>A Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity Synonymous variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT712867 hsa-miR-758-5p HITS-CLIP 19536157
MIRT712866 hsa-miR-8069 HITS-CLIP 19536157
MIRT712865 hsa-miR-103a-2-5p HITS-CLIP 19536157
MIRT712864 hsa-miR-380-5p HITS-CLIP 19536157
MIRT712863 hsa-miR-563 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17185389, 19815549, 26035863, 32814053, 34731008, 35137054
GO:0005737 Component Cytoplasm IEA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IDA 19815549
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609884 28396 ENSG00000164953
Protein
UniProt ID Q5HYA8
Protein name Meckelin (Meckel syndrome type 3 protein) (Transmembrane protein 67)
Protein function Required for ciliary structure and function. Part of the tectonic-like complex which is required for tissue-specific ciliogenesis and may regulate ciliary membrane composition (By similarity). Involved in centrosome migration to the apical cell
PDB 7FH1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09773 Meckelin 167 995 Meckelin (Transmembrane protein 67) Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed in adult and fetal tissues. Expressed at higher level in spinal cord. {ECO:0000269|PubMed:16415887, ECO:0000269|PubMed:17185389}.
Sequence
MATRGGAGVAMAVWSLLSARAVTAFLLLFLPRFLQAQTFSFPFQQPEKCDNNQYFDISAL
SCVPCGANQRQDARGTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSD
LTAEGKCHCPIGHILVERDINGTLLSQATCELCDGNENSFMVVNALGDRCVRCEPTFVNT
SRSCACSEPNILTGGLCFSSTGNFPLRRISAARYGEVGMSLTSEWFAKYLQSSAAACWVY
ANLTSCQALGNMCVMNMNSYDFATFDACGLFQFIFENTAGLSTVHSISFWRQNLPWLFYG
DQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQTLEGGVLQLCPDT
ETRLNAAYSFGTTYQQNCEIPISKILIDFPTPIFYDVYLEYTDENQHQYILAVPVLNLNL
QHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPNTIN
GNIYPPLITIAYSDIDIKDANSQSVKVSFSVTYEMDHGEAHVQTDIALGVLGGLAVLASL
LKTAGWKRRIGSPMIDLQTVVKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLL
PMPIQEERFVTYVGCAFALKALQFLHKLISQITIDVFFIDWERPKGKVLKAVEGEGGVRS
ATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLEVVGFKNLALMDSSSSLSRNP
PSYIAPYSCILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLCSMSNISVFLL
SHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMR
QHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYFIKDKL
LLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILA
SFLTYLQQEIFRYIRNTVGQKNLASKTLVDQRFLI
Sequence length 995
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Anchoring of the basal body to the plasma membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Joubert Syndrome joubert syndrome 6, Joubert syndrome and related disorders, joubert syndrome 1 rs863225225, rs386834202, rs751309268, rs137853108, rs751517725, rs267607116, rs863225226, rs863225240, rs137853107, rs863225229, rs386834180, rs267607119, rs201893408, rs863225227, rs863225230
View all (24 more)
N/A
Joubert syndrome with congenital hepatic fibrosis COACH syndrome 1 rs1554615516, rs267607119, rs137853107, rs786200867, rs758948621, rs786200868, rs267607115, rs775883520 N/A
Meckel syndrome Meckel syndrome, type 3 rs386834188, rs137853106, rs386834180, rs386834190, rs386834187, rs386834191, rs765468645, rs386834203, rs386834194, rs747025617, rs386834205, rs386834181, rs386834195, rs267607119, rs386834182
View all (18 more)
N/A
Meckel-Gruber Syndrome meckel-gruber syndrome rs765468645, rs386834180, rs587779736 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bardet-Biedl Syndrome Bardet-Biedl syndrome 14 N/A N/A ClinVar
Cerebellar vermis agenesis familial aplasia of the vermis N/A N/A ClinVar
Insomnia Insomnia N/A N/A GWAS
Mental retardation intellectual disability N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Agenesis of Cerebellar Vermis Associate 17160906, 17960139, 18950740, 19058225, 19540516, 19574260, 27491411, 29146704, 32000717, 33432080, 37131188, 37910852, 38502237
Anemia Associate 19540516
Aphasia Conduction Associate 37910852
Apraxia oculomotor Cogan type Associate 19540516
Central Nervous System Vascular Malformations Associate 19540516
Ciliopathies Associate 19540516, 20232449, 21068128, 27491411, 35764379, 37471416
COACH syndrome Associate 19058225, 19574260
Coloboma Associate 19058225, 26092869
Encephalocele Associate 12384791
Esophageal Neoplasms Associate 33463006