Gene Gene information from NCBI Gene database.
Entrez ID 91147
Gene name Transmembrane protein 67
Gene symbol TMEM67
Synonyms (NCBI Gene)
JBTS6MECKELINMKS3NPHP11TNEM67
Chromosome 8
Chromosome location 8q22.1
Summary The protein encoded by this gene localizes to the primary cilium and to the plasma membrane. The gene functions in centriole migration to the apical membrane and formation of the primary cilium. Multiple transcript variants encoding different isoforms hav
SNPs SNP information provided by dbSNP.
105
SNP ID Visualize variation Clinical significance Consequence
rs34779331 C>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, 5 prime UTR variant, non coding transcript variant, missense variant
rs35765535 C>G Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs111619594 A>T Benign, conflicting-interpretations-of-pathogenicity, risk-factor, uncertain-significance Coding sequence variant, intron variant, missense variant, non coding transcript variant
rs111991507 A>G Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, intron variant, synonymous variant, non coding transcript variant
rs115563233 G>A Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity Synonymous variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
254
miRTarBase ID miRNA Experiments Reference
MIRT712867 hsa-miR-758-5p HITS-CLIP 19536157
MIRT712866 hsa-miR-8069 HITS-CLIP 19536157
MIRT712865 hsa-miR-103a-2-5p HITS-CLIP 19536157
MIRT712864 hsa-miR-380-5p HITS-CLIP 19536157
MIRT712863 hsa-miR-563 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17185389, 19815549, 26035863, 32814053, 34731008, 35137054
GO:0005737 Component Cytoplasm IEA
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IDA 19815549
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609884 28396 ENSG00000164953
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5HYA8
Protein name Meckelin (Meckel syndrome type 3 protein) (Transmembrane protein 67)
Protein function Required for ciliary structure and function. Part of the tectonic-like complex which is required for tissue-specific ciliogenesis and may regulate ciliary membrane composition (By similarity). Involved in centrosome migration to the apical cell
PDB 7FH1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09773 Meckelin 167 995 Meckelin (Transmembrane protein 67) Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed in adult and fetal tissues. Expressed at higher level in spinal cord. {ECO:0000269|PubMed:16415887, ECO:0000269|PubMed:17185389}.
Sequence
MATRGGAGVAMAVWSLLSARAVTAFLLLFLPRFLQAQTFSFPFQQPEKCDNNQYFDISAL
SCVPCGANQRQDARGTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSD
LTAEGKCHCPIGHILVERDINGTLLSQATCELCDGNENSFMVVNALGDRCVRCEPTFVNT
SRSCACSEPNILTGGLCFSSTGNFPLRRISAARYGEVGMSLTSEWFAKYLQSSAAACWVY
ANLTSCQALGNMCVMNMNSYDFATFDACGLFQFIFENTAGLSTVHSISFWRQNLPWLFYG
DQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQTLEGGVLQLCPDT
ETRLNAAYSFGTTYQQNCEIPISKILIDFPTPIFYDVYLEYTDENQHQYILAVPVLNLNL
QHNKIFVNQDSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPNTIN
GNIYPPLITIAYSDIDIKDANSQSVKVSFSVTYEMDHGEAHVQTDIALGVLGGLAVLASL
LKTAGWKRRIGSPMIDLQTVVKFLVYYAGDLANVFFIITVGTGLYWLIFFKAQKSVSVLL
PMPIQEERFVTYVGCAFALKALQFLHKLISQITIDVFFIDWERPKGKVLKAVEGEGGVRS
ATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLEVVGFKNLALMDSSSSLSRNP
PSYIAPYSCILRYAVSAALWLAIGIIQVVFFAVFYERFIEDKIRQFVDLCSMSNISVFLL
SHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMR
QHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYFIKDKL
LLERILGMEFMEPMEKSIFYNDEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILA
SFLTYLQQEIFRYIRNTVGQKNLASKTLVDQRFLI
Sequence length 995
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Anchoring of the basal body to the plasma membrane
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2494
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormality of the nervous system Likely pathogenic; Pathogenic rs775883520 RCV001814102
Anhydramnios Likely pathogenic; Pathogenic rs2130735328, rs199821258 RCV001807678
RCV001807679
Bardet-Biedl syndrome Likely pathogenic; Pathogenic rs749435317 RCV000490354
Bardet-Biedl syndrome 14 Likely pathogenic; Pathogenic rs201893408 RCV000763610
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs34022540 RCV005911528
Atypical hemolytic-uremic syndrome Conflicting classifications of pathogenicity rs768929156 RCV002294722
Bardet-Biedl syndrome 14, modifier of Conflicting classifications of pathogenicity rs111619594 RCV000001444
Cervical cancer Conflicting classifications of pathogenicity rs115563233 RCV005895406
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Agenesis of Cerebellar Vermis Associate 17160906, 17960139, 18950740, 19058225, 19540516, 19574260, 27491411, 29146704, 32000717, 33432080, 37131188, 37910852, 38502237
Anemia Associate 19540516
Aphasia Conduction Associate 37910852
Apraxia oculomotor Cogan type Associate 19540516
Central Nervous System Vascular Malformations Associate 19540516
Ciliopathies Associate 19540516, 20232449, 21068128, 27491411, 35764379, 37471416
COACH syndrome Associate 19058225, 19574260
Coloboma Associate 19058225, 26092869
Encephalocele Associate 12384791
Esophageal Neoplasms Associate 33463006