Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9112
Gene name Gene Name - the full gene name approved by the HGNC.	Metastasis associated 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MTA1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcin

Show/Hide all(169)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000033	hsa-miR-661	Review	20026422
MIRT000033	hsa-miR-661	Luciferase reporter assay, Western blot	19584269
MIRT004442	hsa-miR-559	Luciferase reporter assay, Western blot	19584269
MIRT052954	hsa-miR-30c-5p	5.0	22139444
MIRT052954	hsa-miR-30c-5p	5.0	22139444
MIRT052954	hsa-miR-30c-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139444
MIRT052954	hsa-miR-30c-5p	qRT-PCR, Western blot	24595016
MIRT052954	hsa-miR-30c-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23988701
MIRT052954	hsa-miR-30c-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23988701
MIRT694397	hsa-miR-3141	HITS-CLIP	23313552
MIRT694396	hsa-miR-4999-3p	HITS-CLIP	23313552
MIRT069482	hsa-miR-125a-3p	HITS-CLIP	23313552
MIRT694395	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT694394	hsa-miR-3158-5p	HITS-CLIP	23313552
MIRT694393	hsa-miR-1184	HITS-CLIP	23313552
MIRT694392	hsa-miR-1205	HITS-CLIP	23313552
MIRT694391	hsa-miR-17-3p	HITS-CLIP	23313552
MIRT694390	hsa-miR-3616-3p	HITS-CLIP	23313552
MIRT694389	hsa-miR-4721	HITS-CLIP	23313552
MIRT694388	hsa-miR-3184-5p	HITS-CLIP	23313552
MIRT694387	hsa-miR-423-5p	HITS-CLIP	23313552
MIRT694386	hsa-miR-1914-3p	HITS-CLIP	23313552
MIRT694385	hsa-miR-5194	HITS-CLIP	23313552
MIRT694384	hsa-miR-6738-5p	HITS-CLIP	23313552
MIRT694383	hsa-miR-6134	HITS-CLIP	23313552
MIRT694382	hsa-miR-3665	HITS-CLIP	23313552
MIRT694381	hsa-miR-657	HITS-CLIP	23313552
MIRT694380	hsa-miR-3689d	HITS-CLIP	23313552
MIRT694379	hsa-miR-6851-5p	HITS-CLIP	23313552
MIRT694378	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT694377	hsa-miR-486-3p	HITS-CLIP	23313552
MIRT694376	hsa-miR-4710	HITS-CLIP	23313552
MIRT694375	hsa-miR-92a-2-5p	HITS-CLIP	23313552
MIRT694374	hsa-miR-3151-5p	HITS-CLIP	23313552
MIRT694373	hsa-miR-3191-5p	HITS-CLIP	23313552
MIRT694372	hsa-miR-1226-5p	HITS-CLIP	23313552
MIRT694371	hsa-miR-6734-5p	HITS-CLIP	23313552
MIRT694370	hsa-miR-4768-5p	HITS-CLIP	23313552
MIRT694369	hsa-miR-6833-3p	HITS-CLIP	23313552
MIRT694368	hsa-miR-6809-3p	HITS-CLIP	23313552
MIRT694367	hsa-miR-1323	HITS-CLIP	23313552
MIRT069484	hsa-miR-543	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26968810
MIRT069484	hsa-miR-543	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26968810
MIRT069482	hsa-miR-125a-3p	Luciferase reporter assay, qRT-PCR, Western blot	25998575
MIRT069482	hsa-miR-125a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28088556
MIRT694367	hsa-miR-1323	PAR-CLIP	26701625
MIRT694386	hsa-miR-1914-3p	PAR-CLIP	26701625
MIRT694374	hsa-miR-3151-5p	PAR-CLIP	26701625
MIRT694388	hsa-miR-3184-5p	PAR-CLIP	26701625
MIRT694387	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT694377	hsa-miR-486-3p	PAR-CLIP	26701625
MIRT694396	hsa-miR-4999-3p	PAR-CLIP	26701625
MIRT694385	hsa-miR-5194	PAR-CLIP	26701625
MIRT694371	hsa-miR-6734-5p	PAR-CLIP	26701625
MIRT694384	hsa-miR-6738-5p	PAR-CLIP	26701625
MIRT694375	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT694397	hsa-miR-3141	HITS-CLIP	23313552
MIRT694396	hsa-miR-4999-3p	HITS-CLIP	23313552
MIRT069482	hsa-miR-125a-3p	HITS-CLIP	23313552
MIRT694395	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT694394	hsa-miR-3158-5p	HITS-CLIP	23313552
MIRT694393	hsa-miR-1184	HITS-CLIP	23313552
MIRT694392	hsa-miR-1205	HITS-CLIP	23313552
MIRT694391	hsa-miR-17-3p	HITS-CLIP	23313552
MIRT694390	hsa-miR-3616-3p	HITS-CLIP	23313552
MIRT694389	hsa-miR-4721	HITS-CLIP	23313552
MIRT694388	hsa-miR-3184-5p	HITS-CLIP	23313552
MIRT694387	hsa-miR-423-5p	HITS-CLIP	23313552
MIRT694386	hsa-miR-1914-3p	HITS-CLIP	23313552
MIRT694385	hsa-miR-5194	HITS-CLIP	23313552
MIRT694384	hsa-miR-6738-5p	HITS-CLIP	23313552
MIRT694383	hsa-miR-6134	HITS-CLIP	23313552
MIRT694382	hsa-miR-3665	HITS-CLIP	23313552
MIRT694381	hsa-miR-657	HITS-CLIP	23313552
MIRT694380	hsa-miR-3689d	HITS-CLIP	23313552
MIRT694379	hsa-miR-6851-5p	HITS-CLIP	23313552
MIRT694378	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT694377	hsa-miR-486-3p	HITS-CLIP	23313552
MIRT694376	hsa-miR-4710	HITS-CLIP	23313552
MIRT694375	hsa-miR-92a-2-5p	HITS-CLIP	23313552
MIRT694374	hsa-miR-3151-5p	HITS-CLIP	23313552
MIRT694373	hsa-miR-3191-5p	HITS-CLIP	23313552
MIRT694372	hsa-miR-1226-5p	HITS-CLIP	23313552
MIRT694371	hsa-miR-6734-5p	HITS-CLIP	23313552
MIRT694370	hsa-miR-4768-5p	HITS-CLIP	23313552
MIRT694369	hsa-miR-6833-3p	HITS-CLIP	23313552
MIRT694368	hsa-miR-6809-3p	HITS-CLIP	23313552
MIRT694367	hsa-miR-1323	HITS-CLIP	23313552
MIRT1162166	hsa-miR-1283	CLIP-seq
MIRT1162167	hsa-miR-199a-5p	CLIP-seq
MIRT1162168	hsa-miR-199b-5p	CLIP-seq
MIRT1162169	hsa-miR-3143	CLIP-seq
MIRT1162170	hsa-miR-3151	CLIP-seq
MIRT1162171	hsa-miR-3183	CLIP-seq
MIRT1162172	hsa-miR-361-3p	CLIP-seq
MIRT1162173	hsa-miR-3648	CLIP-seq
MIRT1162174	hsa-miR-3670	CLIP-seq
MIRT1162175	hsa-miR-3934	CLIP-seq
MIRT1162176	hsa-miR-4279	CLIP-seq
MIRT1162177	hsa-miR-4669	CLIP-seq
MIRT1162178	hsa-miR-4723-3p	CLIP-seq
MIRT1162179	hsa-miR-4778-3p	CLIP-seq
MIRT1162180	hsa-miR-4797-5p	CLIP-seq
MIRT2046467	hsa-miR-1296	CLIP-seq
MIRT2046468	hsa-miR-1538	CLIP-seq
MIRT2046469	hsa-miR-2909	CLIP-seq
MIRT2046470	hsa-miR-3065-5p	CLIP-seq
MIRT1162169	hsa-miR-3143	CLIP-seq
MIRT1162175	hsa-miR-3934	CLIP-seq
MIRT2046471	hsa-miR-421	CLIP-seq
MIRT2046472	hsa-miR-4258	CLIP-seq
MIRT2046473	hsa-miR-4512	CLIP-seq
MIRT2046474	hsa-miR-4514	CLIP-seq
MIRT2046475	hsa-miR-4645-5p	CLIP-seq
MIRT2046476	hsa-miR-4651	CLIP-seq
MIRT2046477	hsa-miR-4660	CLIP-seq
MIRT2046478	hsa-miR-4665-3p	CLIP-seq
MIRT2046479	hsa-miR-4673	CLIP-seq
MIRT2046480	hsa-miR-4688	CLIP-seq
MIRT2046481	hsa-miR-4692	CLIP-seq
MIRT2046482	hsa-miR-4709-5p	CLIP-seq
MIRT2046483	hsa-miR-4745-3p	CLIP-seq
MIRT2046484	hsa-miR-4749-3p	CLIP-seq
MIRT2046485	hsa-miR-4755-3p	CLIP-seq
MIRT1162180	hsa-miR-4797-5p	CLIP-seq
MIRT2046486	hsa-miR-564	CLIP-seq
MIRT2046487	hsa-miR-608	CLIP-seq
MIRT2046488	hsa-miR-663b	CLIP-seq
MIRT2275575	hsa-miR-183	CLIP-seq
MIRT1162167	hsa-miR-199a-5p	CLIP-seq
MIRT1162168	hsa-miR-199b-5p	CLIP-seq
MIRT2046470	hsa-miR-3065-5p	CLIP-seq
MIRT2275576	hsa-miR-30a	CLIP-seq
MIRT2275577	hsa-miR-30b	CLIP-seq
MIRT2275578	hsa-miR-30c	CLIP-seq
MIRT2275579	hsa-miR-30d	CLIP-seq
MIRT2275580	hsa-miR-30e	CLIP-seq
MIRT1162169	hsa-miR-3143	CLIP-seq
MIRT1162171	hsa-miR-3183	CLIP-seq
MIRT1162172	hsa-miR-361-3p	CLIP-seq
MIRT2275581	hsa-miR-3662	CLIP-seq
MIRT2275582	hsa-miR-3669	CLIP-seq
MIRT2275583	hsa-miR-3917	CLIP-seq
MIRT1162175	hsa-miR-3934	CLIP-seq
MIRT2046471	hsa-miR-421	CLIP-seq
MIRT1162176	hsa-miR-4279	CLIP-seq
MIRT1162177	hsa-miR-4669	CLIP-seq
MIRT2046482	hsa-miR-4709-5p	CLIP-seq
MIRT1162178	hsa-miR-4723-3p	CLIP-seq
MIRT1162179	hsa-miR-4778-3p	CLIP-seq
MIRT1162180	hsa-miR-4797-5p	CLIP-seq
MIRT2275584	hsa-miR-548a-5p	CLIP-seq
MIRT2275585	hsa-miR-548ab	CLIP-seq
MIRT2275586	hsa-miR-548ak	CLIP-seq
MIRT2275587	hsa-miR-548b-5p	CLIP-seq
MIRT2275588	hsa-miR-548c-5p	CLIP-seq
MIRT2275589	hsa-miR-548d-5p	CLIP-seq
MIRT2275590	hsa-miR-548h	CLIP-seq
MIRT2275591	hsa-miR-548i	CLIP-seq
MIRT2275592	hsa-miR-548j	CLIP-seq
MIRT2275593	hsa-miR-548n	CLIP-seq
MIRT2275594	hsa-miR-548w	CLIP-seq
MIRT2275595	hsa-miR-548y	CLIP-seq
MIRT2275596	hsa-miR-572	CLIP-seq
MIRT2275597	hsa-miR-766	CLIP-seq
MIRT1162171	hsa-miR-3183	CLIP-seq
MIRT1162176	hsa-miR-4279	CLIP-seq
MIRT1162178	hsa-miR-4723-3p	CLIP-seq
MIRT1162179	hsa-miR-4778-3p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
LMO4	Unknown	16288053
SP1	Activation	21555589

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	21965678, 24413532
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0001103	Function	RNA polymerase II repressing transcription factor binding	IBA	21873635
GO:0001103	Function	RNA polymerase II repressing transcription factor binding	IPI	22926524
GO:0003682	Function	Chromatin binding	IEA
GO:0003713	Function	Transcription coactivator activity	IBA	21873635
GO:0003713	Function	Transcription coactivator activity	IMP	21965678
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IMP	21965678
GO:0005515	Function	Protein binding	IPI	16511565, 18451879, 19805145, 20651739, 21258344, 21555589, 21965678, 23752268, 24413532, 24970816, 24981860, 25416956, 25609649, 26028330, 26496610, 26949739, 27705803, 29997244, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	21965678, 24413532, 24970816
GO:0005635	Component	Nuclear envelope	IDA	24970816
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	24970816
GO:0005829	Component	Cytosol	IDA
GO:0005874	Component	Microtubule	IDA	24970816
GO:0006302	Process	Double-strand break repair	IBA	21873635
GO:0006302	Process	Double-strand break repair	IMP	19805145
GO:0007165	Process	Signal transduction	TAS	8083195
GO:0008270	Function	Zinc ion binding	IEA
GO:0010212	Process	Response to ionizing radiation	IBA	21873635
GO:0010212	Process	Response to ionizing radiation	IDA	19805145
GO:0016575	Process	Histone deacetylation	IBA	21873635
GO:0016581	Component	NuRD complex	IBA	21873635
GO:0016581	Component	NuRD complex	IDA	22926524
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0040029	Process	Regulation of gene expression, epigenetic	IMP	24413532
GO:0042826	Function	Histone deacetylase binding	IBA	21873635
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	19805145
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0045475	Process	Locomotor rhythm	ISS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IEA
GO:1902499	Process	Positive regulation of protein autoubiquitination	IDA	19805145

MIM	HGNC	e!Ensembl
603526	7410	ENSG00000182979

Protein

UniProt ID

Q13330

Protein name

Metastasis-associated protein MTA1

Protein function

Transcriptional coregulator which can act as both a transcriptional corepressor and coactivator (PubMed:16617102, PubMed:17671180, PubMed:17922032, PubMed:21965678, PubMed:24413532). Acts as a component of the histone deacetylase NuRD complex wh

PDB

4BKX , 4PBY , 4PBZ , 4PC0 , 5FXY , 5ICN , 6G16 , 6ZRC , 6ZRD , 7AO8 , 7AO9 , 7AOA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01426	BAH	4 → 164	BAH domain	Domain
PF01448	ELM2	167 → 219	ELM2 domain	Family
PF00249	Myb_DNA-binding	285 → 331	Myb-like DNA-binding domain	Domain
PF00320	GATA	393 → 430	GATA zinc finger	Domain
PF17226	MTA_R1	464 → 541	MTA R1 domain	Domain
PF17226	MTA_R1	656 → 695	MTA R1 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. High expression in brain, liver, kidney, and cardiac muscle, ovaries, adrenal glands and virgin mammary glands. Higher in tumors than in adjacent normal tissue from the same individual. Up-regulated in a wide variety

Sequence

MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALAD
KHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPAT
HIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDL
LKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHM
SAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEAL
EKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYN
KPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASC
WTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTR
IARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRY
LETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLL
MPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYM
ATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED

Sequence length

715

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling		HDACs deacetylate histones SUMOylation of transcription factors RNA Polymerase I Transcription Initiation Regulation of PTEN gene transcription

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	27044752

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Endometriosis	Endometriosis		22138541	ClinVar

Show/Hide Text Mining Associations (64)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoid tumor	Associate	16794389
Adenocarcinoma	Associate	36103249
Bone Diseases Metabolic	Stimulate	21448429
Breast Neoplasms	Associate	10206283, 12527756, 15254226, 16511565, 16617102, 16630134, 21595884, 21990379, 22270359, 22644675, 25811737, 28393842, 30642362, 30782165, 35369814, 35534547, 36539038, 40565190 View all (3 more)
Carcinogenesis	Associate	20010875, 21555589, 23371285, 26689197
Carcinoid Tumor	Stimulate	16502410
Carcinoid Tumor	Associate	16831056
Carcinoma Basal Cell	Stimulate	16831056
Carcinoma Hepatocellular	Associate	20010875, 25472720, 28861931, 36575438
Carcinoma Non Small Cell Lung	Associate	20661085, 23343746, 23718732, 23988701, 25998575, 28443468
Carcinoma Ovarian Epithelial	Associate	25501238
Carcinoma Renal Cell	Associate	33059651
Carcinoma Small Cell	Associate	17469181
Carcinoma Squamous Cell	Stimulate	36689059
Chromosome Disorders	Associate	17922032
Colorectal Neoplasms	Associate	19198625, 21448429, 22363125, 23371285, 27320813, 30610787, 34337713
Death	Associate	22537306
Depressive Disorder	Associate	21595884
Dyslexia	Inhibit	21555589
Endocrine Gland Neoplasms	Stimulate	19377441
Endometrial Neoplasms	Associate	24595016, 28656791
Endometriosis	Associate	30170442
Esophageal Squamous Cell Carcinoma	Associate	10206283, 27035126
Gastritis Atrophic	Associate	30249557
Genital Neoplasms Female	Stimulate	36689059
Glycogen Storage Disease Type IV	Stimulate	16502410
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	36689059
Hypoxia	Stimulate	16511565
Hypoxia	Associate	30782165
Hypoxia Brain	Stimulate	30782165
Inflammation	Associate	20010875, 37892177
Inflammatory Breast Neoplasms	Associate	25811737
Intestinal Diseases	Stimulate	30249557
Intracranial Arteriovenous Malformations	Associate	37892177
Kidney Neoplasms	Associate	33059651
Lung Neoplasms	Associate	23988701, 24853685, 26698569
Lymphatic Diseases	Associate	10206283
Lymphatic Metastasis	Stimulate	10206283, 21448429, 26698569, 27035126, 34182519
Lymphatic Metastasis	Associate	20661085, 25301048
Lymphoma B Cell	Associate	16831056
Mesothelioma Malignant	Associate	26689197
Nasopharyngeal Carcinoma	Associate	22537306, 32458989
Neoplasm Invasiveness	Associate	10206283
Neoplasm Metastasis	Associate	10206283, 12431981, 12920132, 14735193, 16502410, 16511565, 16630134, 18719363, 19197975, 21555589, 21595884, 22644675, 23227138, 23343746, 23371285 View all (13 more)
Neoplasm Metastasis	Stimulate	22537306
Neoplasm Metastasis	Inhibit	30642362
Neoplasms	Associate	10206283, 14735193, 16502410, 16511565, 16630134, 16831056, 18719363, 20010875, 20661085, 21448429, 21555589, 21595884, 21990379, 23343746, 24595016 View all (11 more)
Neoplasms	Stimulate	16309230, 17922032, 19377441, 27035126, 30782165
Neoplasms	Inhibit	20697987
Neoplasms Glandular and Epithelial	Associate	14735193
Neuroendocrine Tumors	Associate	16794389, 16831056, 19197975
Non functioning pancreatic endocrine tumor	Associate	19377441
Osteosarcoma	Associate	35642705
Ovarian Neoplasms	Stimulate	18719363
Ovarian Neoplasms	Associate	25501238, 28901313
Pancreatic Neoplasms	Associate	14735193, 28635511
Paraganglioma	Associate	16831056
Parkinson Disease	Associate	36010675, 38027039
Prostatic Neoplasms	Associate	23227138, 23900262, 25797255, 31487842, 37143720
Squamous Cell Carcinoma of Head and Neck	Associate	25301048, 34182519
Stomach Neoplasms	Associate	25793713
Stomach Neoplasms	Stimulate	30249557
Uterine Cervical Neoplasms	Associate	30344797
Vulvar Neoplasms	Associate	36689059

MTA1 (metastasis associated 1)