Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9104
Gene name Gene Name - the full gene name approved by the HGNC.	Regucalcin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RGN
Synonyms (NCBI Gene) Gene synonyms aliases	GNL, HEL-S-41, RC, SMP30
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp11.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023777	hsa-miR-1-3p	Microarray	18668037

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
SP1	Repression	21526343

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001822	Process	Kidney development	IEA
GO:0004341	Function	Gluconolactonase activity	IBA	21873635
GO:0004341	Function	Gluconolactonase activity	IDA	20329768, 23349732
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005509	Function	Calcium ion binding	IDA	20329768
GO:0005509	Function	Calcium ion binding	ISS
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	IEA
GO:0006874	Process	Cellular calcium ion homeostasis	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007568	Process	Aging	IEA
GO:0008270	Function	Zinc ion binding	IDA	20329768
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IEA
GO:0010907	Process	Positive regulation of glucose metabolic process	IEA
GO:0010922	Process	Positive regulation of phosphatase activity	IEA
GO:0019853	Process	L-ascorbic acid biosynthetic process	IBA	21873635
GO:0030234	Function	Enzyme regulator activity	IEA
GO:0032515	Process	Negative regulation of phosphoprotein phosphatase activity	IEA
GO:0032781	Process	Positive regulation of ATPase activity	ISS
GO:0034260	Process	Negative regulation of GTPase activity	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045723	Process	Positive regulation of fatty acid biosynthetic process	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050848	Process	Regulation of calcium-mediated signaling	ISS
GO:0051344	Process	Negative regulation of cyclic-nucleotide phosphodiesterase activity	IEA
GO:0097421	Process	Liver regeneration	IEA
GO:1901318	Process	Negative regulation of flagellated sperm motility	IEA
GO:1901671	Process	Positive regulation of superoxide dismutase activity	IEA
GO:1901896	Process	Positive regulation of ATPase-coupled calcium transmembrane transporter activity	IEA
GO:1902679	Process	Negative regulation of RNA biosynthetic process	IEA
GO:1903011	Process	Negative regulation of bone development	IEA
GO:1903052	Process	Positive regulation of proteolysis involved in cellular protein catabolic process	IEA
GO:1903611	Process	Negative regulation of calcium-dependent ATPase activity	IEA
GO:1903625	Process	Negative regulation of DNA catabolic process	IEA
GO:1903629	Process	Positive regulation of dUTP diphosphatase activity	IEA
GO:1903634	Process	Negative regulation of leucine-tRNA ligase activity	IEA
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
300212	9989	ENSG00000130988

Protein

UniProt ID

Q15493

Protein name

Regucalcin (RC) (Gluconolactonase) (GNL) (EC 3.1.1.17) (Senescence marker protein 30) (SMP-30)

Protein function

Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca(2+) signaling,

PDB

3G4E , 3G4H , 4GNB , 4GNC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08450	SGL	16 → 264	SMP-30/Gluconolactonase/LRE-like region	Family

Sequence

MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSS
VALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAE
ETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDY
DLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKL
PVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG

Sequence length

299

Interactions

View interactions

	KEGG
	Pentose phosphate pathway Ascorbate and aldarate metabolism Metabolic pathways Carbon metabolism Biosynthesis of cofactors

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Kidney disease	Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	18805471

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Inhibit	31718698
Astrocytoma	Associate	31683628
Blood Coagulation Disorders	Associate	27991558
Breast Neoplasms	Associate	21687737
Carcinogenesis	Inhibit	30720065
Carcinoma Hepatocellular	Associate	23725145, 24606440, 27991558
Carcinoma Non Small Cell Lung	Associate	31718698
Carcinoma Renal Cell	Inhibit	30387835
Carcinoma Squamous Cell	Associate	37161020
Cataract	Stimulate	26619319
Cataract	Associate	28765965
Cataract Age Related Nuclear	Associate	35615975
Colorectal Neoplasms	Associate	30720065
Glioblastoma	Associate	31683628
Inflammation	Associate	38168909
Kidney Neoplasms	Associate	30387835
Lichen Planus Oral	Associate	36656203
Microcephaly	Associate	31683628
Muscle Neoplasms	Associate	31683628
Muscular Dystrophy Duchenne	Associate	26762977
Neoplasms	Inhibit	24606440, 30066859, 30387835, 37161020
Neoplasms	Associate	27991558, 31718698
Pulmonary Disease Chronic Obstructive	Associate	33057025
Rhabdomyosarcoma	Associate	31683628
Stomach Neoplasms	Associate	32878427

RGN (regucalcin)