FCGR2C (Fc gamma receptor IIc (gene/pseudogene))

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 9103
Gene name Fc gamma receptor IIc (gene/pseudogene)
Gene symbol FCGR2C
Synonyms (NCBI Gene)
CD32CD32CCDW32FCG2FCRIICFcgammaRIIcIGFR2
Chromosome 1
Chromosome location 1q23.3
Summary This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing o
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT1994747 hsa-miR-512-5p CLIP-seq
MIRT1994748 hsa-miR-545 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0001788 Process Antibody-dependent cellular cytotoxicity IBA
GO:0002682 Process Regulation of immune system process IEA
GO:0004888 Function Transmembrane signaling receptor activity NAS 2531080
GO:0005515 Function Protein binding IPI 17474147, 17785206
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
612169 15626 HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P31995
Protein name Low affinity immunoglobulin gamma Fc region receptor II-c (IgG Fc receptor II-c) (CDw32) (Fc-gamma RII-c) (Fc-gamma-RIIc) (FcRII-c) (CD antigen CD32)
Protein function Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
PDB 3WJL , 6YAX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 49 → 128 Immunoglobulin domain Domain
PF13895 Ig_2 132 → 214 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.
Sequence 
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPR
APTDDDKNIYLTLPPNDHVNSNN
Sequence length 323
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Phagosome
Osteoclast differentiation
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis 		 
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Uncertain significance rs367710761 RCV005932514
Show/Hide Text Mining Associations (19)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 24731980
Anemia Sickle Cell Associate 30663491
Arthritis Psoriatic Associate 39684939
Dermatitis Atopic Associate 39684939
Head and Neck Neoplasms Associate 36010616
HIV Infections Associate 30563969, 31434737
Huntington Disease Associate 27742794
Inflammation Associate 39684939
Lupus Erythematosus Systemic Associate 23261299, 36371989
Lymphoma Extranodal NK T Cell Associate 34872521