Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9103
Gene name Gene Name - the full gene name approved by the HGNC.
Fc gamma receptor IIc (gene/pseudogene)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FCGR2C
Synonyms (NCBI Gene) Gene synonyms aliases
CD32, CD32C, CDW32, FCG2, FCRIIC, FcgammaRIIc, IGFR2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing o
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1994747 hsa-miR-512-5p CLIP-seq
MIRT1994748 hsa-miR-545 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001788 Process Antibody-dependent cellular cytotoxicity IBA
GO:0002682 Process Regulation of immune system process IEA
GO:0004888 Function Transmembrane signaling receptor activity NAS 2531080
GO:0005515 Function Protein binding IPI 17474147, 17785206
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612169 15626 HGNC
Protein
UniProt ID P31995
Protein name Low affinity immunoglobulin gamma Fc region receptor II-c (IgG Fc receptor II-c) (CDw32) (Fc-gamma RII-c) (Fc-gamma-RIIc) (FcRII-c) (CD antigen CD32)
Protein function Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
PDB 3WJL , 6YAX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13895 Ig_2 49 128 Immunoglobulin domain Domain
PF13895 Ig_2 132 214 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform IIC1 is detected in monocytes, macrophages, polymorphonuclear cells and natural killer cells.
Sequence
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTV
LSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITV
QAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPR
APTDDDKNIYLTLPPNDHVNSNN
Sequence length 323
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Phagosome
Osteoclast differentiation
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes (SNP x SNP interaction, 2df) N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 24731980
Anemia Sickle Cell Associate 30663491
Arthritis Psoriatic Associate 39684939
Dermatitis Atopic Associate 39684939
Head and Neck Neoplasms Associate 36010616
HIV Infections Associate 30563969, 31434737
Huntington Disease Associate 27742794
Inflammation Associate 39684939
Lupus Erythematosus Systemic Associate 23261299, 36371989
Lymphoma Extranodal NK T Cell Associate 34872521