Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9096
Gene name Gene Name - the full gene name approved by the HGNC.
T-box transcription factor 18
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TBX18
Synonyms (NCBI Gene) Gene synonyms aliases
CAKUT2, PUJO
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q14.3
Summary Summary of gene provided in NCBI Entrez Gene.
This genes codes for a member of an evolutionarily conserved family of transcription factors that plays a crucial role in embryonic development. The family is characterized by the presence of the DNA-binding T-box domain and is divided into five sub-famil
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs760905589 G>A Pathogenic Missense variant, intron variant, coding sequence variant
rs797045022 T>C Pathogenic Coding sequence variant, missense variant
rs869320679 C>- Pathogenic Frameshift variant, coding sequence variant
rs886041719 G>A Uncertain-significance, pathogenic Stop gained, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT036442 hsa-miR-1226-3p CLASH 23622248
MIRT713701 hsa-miR-6758-3p HITS-CLIP 19536157
MIRT713700 hsa-miR-6505-5p HITS-CLIP 19536157
MIRT553728 hsa-miR-6835-3p PAR-CLIP 21572407
MIRT553727 hsa-miR-4422 PAR-CLIP 21572407
Transcription factors
Transcription factor Regulation Reference
POU5F1 Repression 17068183
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604613 11595 ENSG00000112837
Protein
UniProt ID O95935
Protein name T-box transcription factor TBX18 (T-box protein 18)
Protein function Acts as a transcriptional repressor involved in developmental processes of a variety of tissues and organs, including the heart and coronary vessels, the ureter and the vertebral column. Required for embryonic development of the sino atrial node
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00907 T-box 141 330 T-box Domain
Sequence
MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGG
AGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKG
SPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLD
PHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVI
SFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKAFSFPE
TVFTTVTAYQNQQITRLKIDRNPFAKGFRD
SGRNRMGLEALVESYAFWRPSLRTLTFEDI
PGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSAC
ARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSC
PQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKL
AASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSS
QVSAHMV
Sequence length 607
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Congenital anomalies of kidney and urinary tract Congenital anomalies of kidney and urinary tract 2, Congenital anomaly of kidney and urinary tract rs869320679, rs760905589, rs797045022 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Acne acne vulgaris N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Carpal Tunnel Syndrome Carpal tunnel syndrome N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37082886
Atherosclerosis Associate 30529831
Cakut Associate 26235987
Heart Defects Congenital Associate 29904178
Multicystic renal dysplasia bilateral Associate 26235987
Urologic Diseases Associate 26235987