ESAM (endothelial cell adhesion molecule)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
90952
Gene name Gene Name - the full gene name approved by the HGNC.
Endothelial cell adhesion molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ESAM
Synonyms (NCBI Gene) Gene synonyms aliases
NEDIHSS, W117m
Disease Acronyms (UniProt) Disease acronyms from UniProt database
NEDIHSS
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(16)
miRTarBase ID miRNA Experiments Reference
MIRT016818 hsa-miR-335-5p Microarray 18185580
MIRT970123 hsa-miR-1207-3p CLIP-seq
MIRT970124 hsa-miR-1913 CLIP-seq
MIRT970125 hsa-miR-3173-3p CLIP-seq
MIRT970126 hsa-miR-324-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 26607202, 32296183
GO:0005886 Component Plasma membrane IDA 20298433
GO:0005886 Component Plasma membrane TAS
GO:0005911 Component Cell-cell junction IDA 20298433
GO:0005912 Component Adherens junction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
614281 17474 ENSG00000149564
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q96AP7
Protein name Endothelial cell-selective adhesion molecule
Protein function Can mediate aggregation most likely through a homophilic molecular interaction.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 36 → 150 Immunoglobulin V-set domain Domain
PF13927 Ig_3 155 → 228 Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in endothelial cells. {ECO:0000269|PubMed:11279107, ECO:0000269|PubMed:36996813}.
Sequence 
MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEV
SSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKD
SGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSK
PAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLE
VSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKS
SDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISP
IPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
Sequence length 390
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cell adhesion molecules
Leukocyte transendothelial migration 		  Cell surface interactions at the vascular wall
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 21822266
Show/Hide Text Mining Associations (17)
Associations from Text Mining
Disease Name Relationship Type References
Atherosclerosis Associate 26523992
Developmental Disabilities Associate 38008937
Disease Associate 38008937
Hodgkin Disease Associate 1605306
Hydrocephalus Associate 38008937
Inflammation Stimulate 16412024
Intracranial Hemorrhages Associate 38008937
Language Development Disorders Associate 38008937
Leukemia Associate 33539590
Leukemia Myeloid Acute Associate 23233446, 33539590