Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9095
Gene name Gene Name - the full gene name approved by the HGNC.
T-box transcription factor 19
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TBX19
Synonyms (NCBI Gene) Gene synonyms aliases
TBS19, TPIT, dJ747L4.1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in p
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs74315376 C>T Pathogenic Stop gained, coding sequence variant
rs74315377 C>T Pathogenic Missense variant, coding sequence variant
rs74315378 T>G Pathogenic Missense variant, coding sequence variant
rs140528998 C>G,T Pathogenic Coding sequence variant, synonymous variant, stop gained
rs200043223 T>C Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003092 hsa-miR-122-5p Luciferase reporter assay, qRT-PCR 19296470
MIRT017792 hsa-miR-335-5p Microarray 18185580
MIRT019806 hsa-miR-375 Microarray 20215506
MIRT1415105 hsa-miR-106a CLIP-seq
MIRT1415106 hsa-miR-106b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604614 11596 ENSG00000143178
Protein
UniProt ID O60806
Protein name T-box transcription factor TBX19 (T-box protein 19) (T-box factor, pituitary)
Protein function Transcriptional regulator involved in developmental processes. Can activate POMC gene expression and repress the alpha glycoprotein subunit and thyroid-stimulating hormone beta promoters.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00907 T-box 43 218 T-box Domain
Sequence
MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNE
MIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHS
CVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRM
VTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLD
AKERNHLRDVPEAISESQHVTY
SHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHR
NHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTIS
NGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVST
WTAVASHPFAGWGGPGAGGHHSPSSLDG
Sequence length 448
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder 17585962 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Acromegaly Associate 28865461
ACTH Deficiency Isolated Associate 36890856
ACTH Secreting Pituitary Adenoma Associate 25942479, 33071973, 33168897, 33584540, 38167466, 38443009
Adenoma Associate 18079591
Autoimmune Hypophysitis Associate 22193973
Carcinogenesis Associate 23778486, 29199261
Cavernous Sinus Thrombosis Stimulate 39982832
Colonic Diseases Stimulate 29199261
Colorectal Neoplasms Stimulate 29199261
Cushing Syndrome Associate 33071973