Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9093
Gene name Gene Name - the full gene name approved by the HGNC.
DnaJ heat shock protein family (Hsp40) member A3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAJA3
Synonyms (NCBI Gene) Gene synonyms aliases
HCA57, TID1, Tid1-L, Tid1-S, hTID-1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the DNAJ/Hsp40 protein family. DNAJ/Hsp40 proteins stimulate the ATPase activity of Hsp70 chaperones and play critical roles in protein folding, degradation, and multimeric complex assembly. The encoded protein is localized t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029308 hsa-miR-26b-5p Microarray 19088304
MIRT049135 hsa-miR-92a-3p CLASH 23622248
MIRT048688 hsa-miR-99a-5p CLASH 23622248
MIRT045410 hsa-miR-149-5p CLASH 23622248
MIRT043778 hsa-miR-328-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 21106534
GO:0005515 Function Protein binding IPI 10411904, 16713569, 17230190, 17500595, 17588722, 21106534, 23455924, 32296183, 32814053
GO:0005524 Function ATP binding IEA
GO:0005634 Component Nucleus IEA
GO:0005739 Component Mitochondrion IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608382 11808 ENSG00000103423
Protein
UniProt ID Q96EY1
Protein name DnaJ homolog subfamily A member 3, mitochondrial (DnaJ protein Tid-1) (hTid-1) (Hepatocellular carcinoma-associated antigen 57) (Tumorous imaginal discs protein Tid56 homolog)
Protein function Modulates apoptotic signal transduction or effector structures within the mitochondrial matrix. Affect cytochrome C release from the mitochondria and caspase 3 activation, but not caspase 8 activation. Isoform 1 increases apoptosis triggered by
PDB 2CTT , 2DN9 , 6IWS , 7X89
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00226 DnaJ 93 155 DnaJ domain Domain
PF01556 DnaJ_C 209 413 DnaJ C terminal domain Domain
PF00684 DnaJ_CXXCXGXG 236 302 DnaJ central domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in heart, liver, lung and skeletal muscles (PubMed:9683573). Also expressed in keratinocytes; expression level and distribution is altered in basal cell carcinomas (PubMed:12783860, PubMed:9683573).
Sequence
MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRAL
LTLRPGVSLTGTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKY
HPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYD
AYGSAGFDPGASGSQHSYWKGGPTV
DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCN
GKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQ
KK
RVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLG
GTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVP
KRLTSRQ
QSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS
Sequence length 480
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Viral carcinogenesis  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
26198764
Unknown
Disease term Disease name Evidence References Source
Neurodevelopmental Disorders complex neurodevelopmental disorder GenCC
Erectile Dysfunction Erectile Dysfunction GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Inhibit 11719219
Alzheimer Disease Associate 26687188, 36776048
Basal Ganglia Diseases Associate 30770860
Breast Neoplasms Associate 21311096, 35779338
Carcinogenesis Associate 26919236
Carcinoma Non Small Cell Lung Associate 26919236
Cerebral Infarction Associate 39735968
Developmental Disabilities Associate 30770860
Head and Neck Neoplasms Inhibit 26919236
Intellectual Disability Associate 30770860