Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9088
Gene name Gene Name - the full gene name approved by the HGNC.
Protein kinase, membrane associated tyrosine/threonine 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PKMYT1
Synonyms (NCBI Gene) Gene synonyms aliases
MYT1, PPP1R126
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the serine/threonine protein kinase family. The encoded protein is a membrane-associated kinase that negatively regulates the G2/M transition of the cell cycle by phosphorylating and inactivating cyclin-dependent kinase 1. Th
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016346 hsa-miR-193b-3p Microarray 20304954
MIRT050725 hsa-miR-18a-5p CLASH 23622248
MIRT042806 hsa-miR-339-5p CLASH 23622248
MIRT439958 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT439959 hsa-miR-20a-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity TAS 9001210
GO:0000086 Process G2/M transition of mitotic cell cycle TAS
GO:0000139 Component Golgi membrane IEA
GO:0000166 Function Nucleotide binding IEA
GO:0000278 Process Mitotic cell cycle TAS 9001210
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602474 29650 ENSG00000127564
Protein
UniProt ID Q99640
Protein name Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase)
Protein function Acts as a negative regulator of entry into mitosis (G2 to M transition) by phosphorylation of the CDK1 kinase specifically when CDK1 is complexed to cyclins (PubMed:10373560, PubMed:10504341, PubMed:9001210, PubMed:9268380). Mediates phosphoryla
PDB 3P1A , 5VCV , 5VCW , 5VCX , 5VCY , 5VCZ , 5VD0 , 5VD1 , 5VD3 , 8D6C , 8D6D , 8D6E , 8D6F , 8WJY , 8ZTX , 8ZU2 , 8ZUD , 8ZUL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 110 359 Protein kinase domain Domain
Sequence
MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGS
IPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGS
YGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG
GILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIF
LGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVA
CNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVL
R
QPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSF
PSFEPRNLLSLFEDTLDPT
Sequence length 499
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
  Polo-like kinase mediated events
Cyclin A/B1/B2 associated events during G2/M transition
G2/M DNA replication checkpoint
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Osteosarcoma Osteosarcoma PKMYT1 and TP53RK showed higher expression in osteosarcoma than in normal bone tissue, whereas TRRAP showed no significant difference. High expression of all 3 kinases was associated with relatively poor prognosis in patients with osteosarcoma. 32944406 CBGDA
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bloom Syndrome Stimulate 31837068
Breast Neoplasms Stimulate 31837068
Breast Neoplasms Associate 35472078, 38291367
Carcinogenesis Associate 31837068
Carcinoma Hepatocellular Associate 31173292
Carcinoma Non Small Cell Lung Associate 31173292
Carcinoma Renal Cell Associate 33024069, 34959223
Colorectal Neoplasms Associate 31173292
Glioblastoma Associate 26673326
Hepatitis B Stimulate 31837068