Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9088
Gene name Gene Name - the full gene name approved by the HGNC.	Protein kinase, membrane associated tyrosine/threonine 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PKMYT1
Synonyms (NCBI Gene) Gene synonyms aliases	MYT1, PPP1R126
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the serine/threonine protein kinase family. The encoded protein is a membrane-associated kinase that negatively regulates the G2/M transition of the cell cycle by phosphorylating and inactivating cyclin-dependent kinase 1. Th

Show/Hide all(135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016346	hsa-miR-193b-3p	Microarray	20304954
MIRT050725	hsa-miR-18a-5p	CLASH	23622248
MIRT042806	hsa-miR-339-5p	CLASH	23622248
MIRT439958	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439959	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439958	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726928	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726929	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726927	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726926	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439959	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT439958	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT726928	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT439959	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726929	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726926	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT726927	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT1237723	hsa-miR-106a	CLIP-seq
MIRT1237724	hsa-miR-106b	CLIP-seq
MIRT1237725	hsa-miR-1253	CLIP-seq
MIRT1237726	hsa-miR-17	CLIP-seq
MIRT1237727	hsa-miR-185	CLIP-seq
MIRT1237728	hsa-miR-20a	CLIP-seq
MIRT1237729	hsa-miR-20b	CLIP-seq
MIRT1237730	hsa-miR-296-5p	CLIP-seq
MIRT1237731	hsa-miR-3184	CLIP-seq
MIRT1237732	hsa-miR-3919	CLIP-seq
MIRT1237733	hsa-miR-423-5p	CLIP-seq
MIRT1237734	hsa-miR-4306	CLIP-seq
MIRT1237735	hsa-miR-4644	CLIP-seq
MIRT1237736	hsa-miR-4740-3p	CLIP-seq
MIRT1237737	hsa-miR-498	CLIP-seq
MIRT1237738	hsa-miR-519a	CLIP-seq
MIRT1237739	hsa-miR-519d	CLIP-seq
MIRT1237740	hsa-miR-548n	CLIP-seq
MIRT1237741	hsa-miR-548t	CLIP-seq
MIRT1237742	hsa-miR-591	CLIP-seq
MIRT1237743	hsa-miR-93	CLIP-seq
MIRT1237723	hsa-miR-106a	CLIP-seq
MIRT1237724	hsa-miR-106b	CLIP-seq
MIRT1237725	hsa-miR-1253	CLIP-seq
MIRT1237726	hsa-miR-17	CLIP-seq
MIRT1237727	hsa-miR-185	CLIP-seq
MIRT1237728	hsa-miR-20a	CLIP-seq
MIRT1237729	hsa-miR-20b	CLIP-seq
MIRT1237730	hsa-miR-296-5p	CLIP-seq
MIRT1237731	hsa-miR-3184	CLIP-seq
MIRT1237732	hsa-miR-3919	CLIP-seq
MIRT1237733	hsa-miR-423-5p	CLIP-seq
MIRT1237734	hsa-miR-4306	CLIP-seq
MIRT2069887	hsa-miR-4462	CLIP-seq
MIRT2069888	hsa-miR-4514	CLIP-seq
MIRT1237735	hsa-miR-4644	CLIP-seq
MIRT2069889	hsa-miR-4645-5p	CLIP-seq
MIRT2069890	hsa-miR-4673	CLIP-seq
MIRT2069891	hsa-miR-4692	CLIP-seq
MIRT1237736	hsa-miR-4740-3p	CLIP-seq
MIRT2069892	hsa-miR-4755-3p	CLIP-seq
MIRT1237737	hsa-miR-498	CLIP-seq
MIRT1237739	hsa-miR-519d	CLIP-seq
MIRT1237740	hsa-miR-548n	CLIP-seq
MIRT1237741	hsa-miR-548t	CLIP-seq
MIRT1237742	hsa-miR-591	CLIP-seq
MIRT1237743	hsa-miR-93	CLIP-seq
MIRT1237723	hsa-miR-106a	CLIP-seq
MIRT1237724	hsa-miR-106b	CLIP-seq
MIRT1237725	hsa-miR-1253	CLIP-seq
MIRT1237726	hsa-miR-17	CLIP-seq
MIRT1237727	hsa-miR-185	CLIP-seq
MIRT1237728	hsa-miR-20a	CLIP-seq
MIRT1237729	hsa-miR-20b	CLIP-seq
MIRT1237730	hsa-miR-296-5p	CLIP-seq
MIRT1237731	hsa-miR-3184	CLIP-seq
MIRT2297238	hsa-miR-3671	CLIP-seq
MIRT1237732	hsa-miR-3919	CLIP-seq
MIRT1237733	hsa-miR-423-5p	CLIP-seq
MIRT1237734	hsa-miR-4306	CLIP-seq
MIRT2069887	hsa-miR-4462	CLIP-seq
MIRT2069888	hsa-miR-4514	CLIP-seq
MIRT1237735	hsa-miR-4644	CLIP-seq
MIRT2069889	hsa-miR-4645-5p	CLIP-seq
MIRT2069890	hsa-miR-4673	CLIP-seq
MIRT2069891	hsa-miR-4692	CLIP-seq
MIRT1237736	hsa-miR-4740-3p	CLIP-seq
MIRT2069892	hsa-miR-4755-3p	CLIP-seq
MIRT1237737	hsa-miR-498	CLIP-seq
MIRT1237738	hsa-miR-519a	CLIP-seq
MIRT1237739	hsa-miR-519d	CLIP-seq
MIRT1237740	hsa-miR-548n	CLIP-seq
MIRT1237741	hsa-miR-548t	CLIP-seq
MIRT1237742	hsa-miR-591	CLIP-seq
MIRT2297239	hsa-miR-607	CLIP-seq
MIRT1237743	hsa-miR-93	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	9001210
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	TAS	9001210
GO:0004672	Function	Protein kinase activity	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	9001210
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9268380
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10373560, 23397142, 23602568, 25852190, 26496610, 28514442, 32296183, 32707033, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	9001210
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	TAS	9001210
GO:0005829	Component	Cytosol	TAS
GO:0007088	Process	Regulation of mitotic nuclear division	TAS	9001210
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	IBA
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	IDA	9268380
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9001210
GO:0016301	Function	Kinase activity	IDA	9268380
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051321	Process	Meiotic cell cycle	IBA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110031	Process	Negative regulation of G2/MI transition of meiotic cell cycle	IBA

MIM	HGNC	e!Ensembl
602474	29650	ENSG00000127564

Protein

UniProt ID

Q99640

Protein name

Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase (EC 2.7.11.1) (Myt1 kinase)

Protein function

Acts as a negative regulator of entry into mitosis (G2 to M transition) by phosphorylation of the CDK1 kinase specifically when CDK1 is complexed to cyclins (PubMed:10373560, PubMed:10504341, PubMed:9001210, PubMed:9268380). Mediates phosphoryla

PDB

3P1A , 5VCV , 5VCW , 5VCX , 5VCY , 5VCZ , 5VD0 , 5VD1 , 5VD3 , 8D6C , 8D6D , 8D6E , 8D6F , 8WJY , 8ZTX , 8ZU2 , 8ZUD , 8ZUL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	110 → 359	Protein kinase domain	Domain

Sequence

MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGS
IPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGS
YGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG
GILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIF
LGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVA
CNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLR
QPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQPLGPPATPPGSPPCS
LLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSF
PSFEPRNLLSLFEDTLDPT

Sequence length

499

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Progesterone-mediated oocyte maturation		Polo-like kinase mediated events Cyclin A/B1/B2 associated events during G2/M transition G2/M DNA replication checkpoint

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Osteosarcoma	Osteosarcoma	PKMYT1 and TP53RK showed higher expression in osteosarcoma than in normal bone tissue, whereas TRRAP showed no significant difference. High expression of all 3 kinases was associated with relatively poor prognosis in patients with osteosarcoma.	32944406	CBGDA

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Bloom Syndrome	Stimulate	31837068
Breast Neoplasms	Stimulate	31837068
Breast Neoplasms	Associate	35472078, 38291367
Carcinogenesis	Associate	31837068
Carcinoma Hepatocellular	Associate	31173292
Carcinoma Non Small Cell Lung	Associate	31173292
Carcinoma Renal Cell	Associate	33024069, 34959223
Colorectal Neoplasms	Associate	31173292
Glioblastoma	Associate	26673326
Hepatitis B	Stimulate	31837068
Hereditary Breast and Ovarian Cancer Syndrome	Associate	31837068
Lymphatic Metastasis	Stimulate	31173292
Neoplasm Metastasis	Stimulate	32495859
Neoplasms	Associate	27452673, 31837068, 33024069, 35444283
Neuroblastoma	Associate	25477524
Osteosarcoma	Stimulate	32944406
Osteosarcoma	Associate	35461324, 40393983
Ovarian Neoplasms	Associate	32495859
Prostatic Neoplasms	Associate	33852421
Stomach Neoplasms	Associate	35114989, 37729973
Triple Negative Breast Neoplasms	Stimulate	31837068
Uterine Cervicitis	Associate	37069588

PKMYT1 (protein kinase, membrane associated tyrosine/threonine 1)