Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	90865
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 33
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL33
Synonyms (NCBI Gene) Gene synonyms aliases	C9orf26, DVS27, IL1F11, NF-HEV, NFEHEV
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p24.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript vari

Show/Hide all(350)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017750	hsa-miR-335-5p	Microarray	18185580
MIRT736393	hsa-miR-524-3p	Western blotting, Microarray, qRT-PCR	31990904
MIRT756199	hsa-miR-181a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34978772
MIRT1064883	hsa-miR-331-3p	CLIP-seq
MIRT1064884	hsa-miR-3660	CLIP-seq
MIRT1064885	hsa-miR-4475	CLIP-seq
MIRT1064886	hsa-miR-4526	CLIP-seq
MIRT1064887	hsa-miR-4645-3p	CLIP-seq
MIRT1064888	hsa-miR-4683	CLIP-seq
MIRT1064889	hsa-miR-4686	CLIP-seq
MIRT1064890	hsa-miR-4732-3p	CLIP-seq
MIRT1064891	hsa-miR-3123	CLIP-seq
MIRT1064892	hsa-miR-3925-5p	CLIP-seq
MIRT1064893	hsa-miR-3974	CLIP-seq
MIRT1064894	hsa-miR-4494	CLIP-seq
MIRT1064895	hsa-miR-499a-5p	CLIP-seq
MIRT1064896	hsa-miR-548a-5p	CLIP-seq
MIRT1064897	hsa-miR-548ab	CLIP-seq
MIRT1064898	hsa-miR-548ak	CLIP-seq
MIRT1064899	hsa-miR-548b-5p	CLIP-seq
MIRT1064900	hsa-miR-548c-5p	CLIP-seq
MIRT1064901	hsa-miR-548d-5p	CLIP-seq
MIRT1064902	hsa-miR-548h	CLIP-seq
MIRT1064903	hsa-miR-548i	CLIP-seq
MIRT1064904	hsa-miR-548j	CLIP-seq
MIRT1064905	hsa-miR-548m	CLIP-seq
MIRT1064906	hsa-miR-548n	CLIP-seq
MIRT1064907	hsa-miR-548w	CLIP-seq
MIRT1064908	hsa-miR-548y	CLIP-seq
MIRT1064909	hsa-miR-559	CLIP-seq
MIRT1064910	hsa-miR-3646	CLIP-seq
MIRT1064911	hsa-miR-3692	CLIP-seq
MIRT1064912	hsa-miR-4519	CLIP-seq
MIRT2015432	hsa-miR-19a	CLIP-seq
MIRT2015433	hsa-miR-19b	CLIP-seq
MIRT2015434	hsa-miR-214	CLIP-seq
MIRT2015435	hsa-miR-3619-5p	CLIP-seq
MIRT2015436	hsa-miR-3665	CLIP-seq
MIRT2015437	hsa-miR-4291	CLIP-seq
MIRT2015438	hsa-miR-4421	CLIP-seq
MIRT2015439	hsa-miR-761	CLIP-seq
MIRT2015440	hsa-miR-764	CLIP-seq
MIRT2015441	hsa-miR-922	CLIP-seq
MIRT2247747	hsa-miR-4282	CLIP-seq
MIRT2451770	hsa-miR-758	CLIP-seq
MIRT2451771	hsa-miR-890	CLIP-seq
MIRT2551235	hsa-miR-105	CLIP-seq
MIRT2551236	hsa-miR-1179	CLIP-seq
MIRT2551237	hsa-miR-1225-5p	CLIP-seq
MIRT2551238	hsa-miR-1237	CLIP-seq
MIRT2551239	hsa-miR-1238	CLIP-seq
MIRT2551240	hsa-miR-1248	CLIP-seq
MIRT2551241	hsa-miR-125a-3p	CLIP-seq
MIRT2551242	hsa-miR-1271	CLIP-seq
MIRT2551243	hsa-miR-1279	CLIP-seq
MIRT2551244	hsa-miR-1282	CLIP-seq
MIRT2551245	hsa-miR-1283	CLIP-seq
MIRT2551246	hsa-miR-134	CLIP-seq
MIRT2551247	hsa-miR-142-5p	CLIP-seq
MIRT2551248	hsa-miR-145	CLIP-seq
MIRT2551249	hsa-miR-154	CLIP-seq
MIRT2551250	hsa-miR-15a	CLIP-seq
MIRT2551251	hsa-miR-15b	CLIP-seq
MIRT2551252	hsa-miR-16	CLIP-seq
MIRT2551253	hsa-miR-182	CLIP-seq
MIRT2551254	hsa-miR-1825	CLIP-seq
MIRT2551255	hsa-miR-186	CLIP-seq
MIRT2551256	hsa-miR-195	CLIP-seq
MIRT2551257	hsa-miR-199a-5p	CLIP-seq
MIRT2551258	hsa-miR-199b-5p	CLIP-seq
MIRT2015432	hsa-miR-19a	CLIP-seq
MIRT2015433	hsa-miR-19b	CLIP-seq
MIRT2551259	hsa-miR-204	CLIP-seq
MIRT2551260	hsa-miR-2053	CLIP-seq
MIRT2551261	hsa-miR-2054	CLIP-seq
MIRT2551262	hsa-miR-211	CLIP-seq
MIRT2015434	hsa-miR-214	CLIP-seq
MIRT2551263	hsa-miR-297	CLIP-seq
MIRT2551264	hsa-miR-3074-3p	CLIP-seq
MIRT2551265	hsa-miR-3118	CLIP-seq
MIRT1064891	hsa-miR-3123	CLIP-seq
MIRT2551266	hsa-miR-3148	CLIP-seq
MIRT2551267	hsa-miR-3149	CLIP-seq
MIRT2551268	hsa-miR-3159	CLIP-seq
MIRT2551269	hsa-miR-3164	CLIP-seq
MIRT2551270	hsa-miR-3174	CLIP-seq
MIRT2551271	hsa-miR-3176	CLIP-seq
MIRT2551272	hsa-miR-3194-3p	CLIP-seq
MIRT2551273	hsa-miR-320e	CLIP-seq
MIRT2551274	hsa-miR-323b-3p	CLIP-seq
MIRT2551275	hsa-miR-330-3p	CLIP-seq
MIRT2551276	hsa-miR-3611	CLIP-seq
MIRT2551277	hsa-miR-361-5p	CLIP-seq
MIRT2551278	hsa-miR-3617	CLIP-seq
MIRT2015435	hsa-miR-3619-5p	CLIP-seq
MIRT2551279	hsa-miR-3622a-3p	CLIP-seq
MIRT2551280	hsa-miR-3622b-3p	CLIP-seq
MIRT2551281	hsa-miR-3622b-5p	CLIP-seq
MIRT1064910	hsa-miR-3646	CLIP-seq
MIRT2551282	hsa-miR-3659	CLIP-seq
MIRT2551283	hsa-miR-3662	CLIP-seq
MIRT2551284	hsa-miR-3663-5p	CLIP-seq
MIRT2015436	hsa-miR-3665	CLIP-seq
MIRT2551285	hsa-miR-3675-3p	CLIP-seq
MIRT2551286	hsa-miR-3682-5p	CLIP-seq
MIRT2551287	hsa-miR-3688-3p	CLIP-seq
MIRT1064911	hsa-miR-3692	CLIP-seq
MIRT2551288	hsa-miR-3921	CLIP-seq
MIRT2551289	hsa-miR-3922-3p	CLIP-seq
MIRT2551290	hsa-miR-3924	CLIP-seq
MIRT2551291	hsa-miR-3925-3p	CLIP-seq
MIRT1064892	hsa-miR-3925-5p	CLIP-seq
MIRT2551292	hsa-miR-3934	CLIP-seq
MIRT2551293	hsa-miR-3942-3p	CLIP-seq
MIRT1064893	hsa-miR-3974	CLIP-seq
MIRT2551294	hsa-miR-409-3p	CLIP-seq
MIRT2551295	hsa-miR-424	CLIP-seq
MIRT2551296	hsa-miR-4253	CLIP-seq
MIRT2551297	hsa-miR-4255	CLIP-seq
MIRT2551298	hsa-miR-4257	CLIP-seq
MIRT2551299	hsa-miR-4259	CLIP-seq
MIRT2247747	hsa-miR-4282	CLIP-seq
MIRT2015437	hsa-miR-4291	CLIP-seq
MIRT2551300	hsa-miR-4292	CLIP-seq
MIRT2551301	hsa-miR-4308	CLIP-seq
MIRT2551302	hsa-miR-4311	CLIP-seq
MIRT2551303	hsa-miR-4312	CLIP-seq
MIRT2551304	hsa-miR-4318	CLIP-seq
MIRT2015438	hsa-miR-4421	CLIP-seq
MIRT2551305	hsa-miR-4423-5p	CLIP-seq
MIRT2551306	hsa-miR-4432	CLIP-seq
MIRT2551307	hsa-miR-4446-5p	CLIP-seq
MIRT1064885	hsa-miR-4475	CLIP-seq
MIRT2551308	hsa-miR-4490	CLIP-seq
MIRT1064894	hsa-miR-4494	CLIP-seq
MIRT2551309	hsa-miR-4495	CLIP-seq
MIRT2551310	hsa-miR-4517	CLIP-seq
MIRT1064912	hsa-miR-4519	CLIP-seq
MIRT2551311	hsa-miR-4524	CLIP-seq
MIRT2551312	hsa-miR-4536	CLIP-seq
MIRT2551313	hsa-miR-4539	CLIP-seq
MIRT2551314	hsa-miR-4639-5p	CLIP-seq
MIRT2551315	hsa-miR-4642	CLIP-seq
MIRT2551316	hsa-miR-4643	CLIP-seq
MIRT1064887	hsa-miR-4645-3p	CLIP-seq
MIRT2551317	hsa-miR-4652-3p	CLIP-seq
MIRT2551318	hsa-miR-4653-5p	CLIP-seq
MIRT2551319	hsa-miR-4658	CLIP-seq
MIRT2551320	hsa-miR-4660	CLIP-seq
MIRT2551321	hsa-miR-4661-5p	CLIP-seq
MIRT2551322	hsa-miR-4670-3p	CLIP-seq
MIRT2551323	hsa-miR-4677-3p	CLIP-seq
MIRT2551324	hsa-miR-4679	CLIP-seq
MIRT2551325	hsa-miR-4682	CLIP-seq
MIRT1064888	hsa-miR-4683	CLIP-seq
MIRT1064889	hsa-miR-4686	CLIP-seq
MIRT2551326	hsa-miR-4694-5p	CLIP-seq
MIRT2551327	hsa-miR-4699-3p	CLIP-seq
MIRT2551328	hsa-miR-4699-5p	CLIP-seq
MIRT2551329	hsa-miR-4709-3p	CLIP-seq
MIRT2551330	hsa-miR-4715-5p	CLIP-seq
MIRT2551331	hsa-miR-4720-3p	CLIP-seq
MIRT2551332	hsa-miR-4738-3p	CLIP-seq
MIRT2551333	hsa-miR-4753-3p	CLIP-seq
MIRT2551334	hsa-miR-4755-5p	CLIP-seq
MIRT2551335	hsa-miR-4761-3p	CLIP-seq
MIRT2551336	hsa-miR-4774-3p	CLIP-seq
MIRT2551337	hsa-miR-4774-5p	CLIP-seq
MIRT2551338	hsa-miR-4778-3p	CLIP-seq
MIRT2551339	hsa-miR-4778-5p	CLIP-seq
MIRT2551340	hsa-miR-4786-3p	CLIP-seq
MIRT2551341	hsa-miR-4789-5p	CLIP-seq
MIRT2551342	hsa-miR-4797-3p	CLIP-seq
MIRT2551343	hsa-miR-4797-5p	CLIP-seq
MIRT2551344	hsa-miR-4804-3p	CLIP-seq
MIRT2551345	hsa-miR-490-3p	CLIP-seq
MIRT2551346	hsa-miR-494	CLIP-seq
MIRT2551347	hsa-miR-495	CLIP-seq
MIRT2551348	hsa-miR-496	CLIP-seq
MIRT2551349	hsa-miR-497	CLIP-seq
MIRT1064895	hsa-miR-499a-5p	CLIP-seq
MIRT2551350	hsa-miR-503	CLIP-seq
MIRT2551351	hsa-miR-513a-5p	CLIP-seq
MIRT2551352	hsa-miR-515-5p	CLIP-seq
MIRT2551353	hsa-miR-520a-5p	CLIP-seq
MIRT2551354	hsa-miR-525-5p	CLIP-seq
MIRT2551355	hsa-miR-532-5p	CLIP-seq
MIRT2551356	hsa-miR-543	CLIP-seq
MIRT1064896	hsa-miR-548a-5p	CLIP-seq
MIRT1064897	hsa-miR-548ab	CLIP-seq
MIRT1064898	hsa-miR-548ak	CLIP-seq
MIRT1064899	hsa-miR-548b-5p	CLIP-seq
MIRT1064900	hsa-miR-548c-5p	CLIP-seq
MIRT1064901	hsa-miR-548d-5p	CLIP-seq
MIRT1064902	hsa-miR-548h	CLIP-seq
MIRT1064903	hsa-miR-548i	CLIP-seq
MIRT1064904	hsa-miR-548j	CLIP-seq
MIRT2551357	hsa-miR-548k	CLIP-seq
MIRT2551358	hsa-miR-548l	CLIP-seq
MIRT1064905	hsa-miR-548m	CLIP-seq
MIRT1064906	hsa-miR-548n	CLIP-seq
MIRT2551359	hsa-miR-548t	CLIP-seq
MIRT2551360	hsa-miR-548u	CLIP-seq
MIRT1064907	hsa-miR-548w	CLIP-seq
MIRT1064908	hsa-miR-548y	CLIP-seq
MIRT1064909	hsa-miR-559	CLIP-seq
MIRT2551361	hsa-miR-561	CLIP-seq
MIRT2551362	hsa-miR-569	CLIP-seq
MIRT2551363	hsa-miR-570	CLIP-seq
MIRT2551364	hsa-miR-574-5p	CLIP-seq
MIRT2551365	hsa-miR-576-3p	CLIP-seq
MIRT2551366	hsa-miR-577	CLIP-seq
MIRT2551367	hsa-miR-579	CLIP-seq
MIRT2551368	hsa-miR-582-3p	CLIP-seq
MIRT2551369	hsa-miR-582-5p	CLIP-seq
MIRT2551370	hsa-miR-590-3p	CLIP-seq
MIRT2551371	hsa-miR-593	CLIP-seq
MIRT2551372	hsa-miR-623	CLIP-seq
MIRT2551373	hsa-miR-641	CLIP-seq
MIRT2551374	hsa-miR-643	CLIP-seq
MIRT2551375	hsa-miR-645	CLIP-seq
MIRT2551376	hsa-miR-646	CLIP-seq
MIRT2551377	hsa-miR-654-3p	CLIP-seq
MIRT2551378	hsa-miR-671-5p	CLIP-seq
MIRT2451770	hsa-miR-758	CLIP-seq
MIRT2551379	hsa-miR-760	CLIP-seq
MIRT2015439	hsa-miR-761	CLIP-seq
MIRT2015440	hsa-miR-764	CLIP-seq
MIRT2551380	hsa-miR-765	CLIP-seq
MIRT2551381	hsa-miR-766	CLIP-seq
MIRT2551382	hsa-miR-767-3p	CLIP-seq
MIRT2551383	hsa-miR-873	CLIP-seq
MIRT2551384	hsa-miR-888	CLIP-seq
MIRT2551385	hsa-miR-889	CLIP-seq
MIRT2451771	hsa-miR-890	CLIP-seq
MIRT2015441	hsa-miR-922	CLIP-seq
MIRT2551386	hsa-miR-96	CLIP-seq
MIRT2551235	hsa-miR-105	CLIP-seq
MIRT2551238	hsa-miR-1237	CLIP-seq
MIRT2551240	hsa-miR-1248	CLIP-seq
MIRT2551245	hsa-miR-1283	CLIP-seq
MIRT2551248	hsa-miR-145	CLIP-seq
MIRT2551249	hsa-miR-154	CLIP-seq
MIRT2551254	hsa-miR-1825	CLIP-seq
MIRT2551255	hsa-miR-186	CLIP-seq
MIRT2551257	hsa-miR-199a-5p	CLIP-seq
MIRT2551258	hsa-miR-199b-5p	CLIP-seq
MIRT2015432	hsa-miR-19a	CLIP-seq
MIRT2015433	hsa-miR-19b	CLIP-seq
MIRT2551260	hsa-miR-2053	CLIP-seq
MIRT2015434	hsa-miR-214	CLIP-seq
MIRT2551264	hsa-miR-3074-3p	CLIP-seq
MIRT1064891	hsa-miR-3123	CLIP-seq
MIRT2551266	hsa-miR-3148	CLIP-seq
MIRT2551268	hsa-miR-3159	CLIP-seq
MIRT2551271	hsa-miR-3176	CLIP-seq
MIRT2551272	hsa-miR-3194-3p	CLIP-seq
MIRT2551274	hsa-miR-323b-3p	CLIP-seq
MIRT2551276	hsa-miR-3611	CLIP-seq
MIRT2551277	hsa-miR-361-5p	CLIP-seq
MIRT2551278	hsa-miR-3617	CLIP-seq
MIRT2015435	hsa-miR-3619-5p	CLIP-seq
MIRT2551279	hsa-miR-3622a-3p	CLIP-seq
MIRT2551280	hsa-miR-3622b-3p	CLIP-seq
MIRT2551281	hsa-miR-3622b-5p	CLIP-seq
MIRT1064910	hsa-miR-3646	CLIP-seq
MIRT2551282	hsa-miR-3659	CLIP-seq
MIRT2551283	hsa-miR-3662	CLIP-seq
MIRT2551284	hsa-miR-3663-5p	CLIP-seq
MIRT2015436	hsa-miR-3665	CLIP-seq
MIRT2551285	hsa-miR-3675-3p	CLIP-seq
MIRT2551287	hsa-miR-3688-3p	CLIP-seq
MIRT1064911	hsa-miR-3692	CLIP-seq
MIRT2551288	hsa-miR-3921	CLIP-seq
MIRT2551289	hsa-miR-3922-3p	CLIP-seq
MIRT2551291	hsa-miR-3925-3p	CLIP-seq
MIRT1064892	hsa-miR-3925-5p	CLIP-seq
MIRT1064893	hsa-miR-3974	CLIP-seq
MIRT2551294	hsa-miR-409-3p	CLIP-seq
MIRT2551296	hsa-miR-4253	CLIP-seq
MIRT2015437	hsa-miR-4291	CLIP-seq
MIRT2551302	hsa-miR-4311	CLIP-seq
MIRT2015438	hsa-miR-4421	CLIP-seq
MIRT2551305	hsa-miR-4423-5p	CLIP-seq
MIRT1064885	hsa-miR-4475	CLIP-seq
MIRT2551308	hsa-miR-4490	CLIP-seq
MIRT1064894	hsa-miR-4494	CLIP-seq
MIRT2551310	hsa-miR-4517	CLIP-seq
MIRT1064912	hsa-miR-4519	CLIP-seq
MIRT2551312	hsa-miR-4536	CLIP-seq
MIRT1064887	hsa-miR-4645-3p	CLIP-seq
MIRT2551318	hsa-miR-4653-5p	CLIP-seq
MIRT2551319	hsa-miR-4658	CLIP-seq
MIRT2551321	hsa-miR-4661-5p	CLIP-seq
MIRT2551322	hsa-miR-4670-3p	CLIP-seq
MIRT2551323	hsa-miR-4677-3p	CLIP-seq
MIRT2551324	hsa-miR-4679	CLIP-seq
MIRT2551325	hsa-miR-4682	CLIP-seq
MIRT1064888	hsa-miR-4683	CLIP-seq
MIRT1064889	hsa-miR-4686	CLIP-seq
MIRT2551326	hsa-miR-4694-5p	CLIP-seq
MIRT2551328	hsa-miR-4699-5p	CLIP-seq
MIRT2551329	hsa-miR-4709-3p	CLIP-seq
MIRT2551332	hsa-miR-4738-3p	CLIP-seq
MIRT2551333	hsa-miR-4753-3p	CLIP-seq
MIRT2551335	hsa-miR-4761-3p	CLIP-seq
MIRT2551336	hsa-miR-4774-3p	CLIP-seq
MIRT2551337	hsa-miR-4774-5p	CLIP-seq
MIRT2551338	hsa-miR-4778-3p	CLIP-seq
MIRT2551339	hsa-miR-4778-5p	CLIP-seq
MIRT2551341	hsa-miR-4789-5p	CLIP-seq
MIRT2551343	hsa-miR-4797-5p	CLIP-seq
MIRT2551345	hsa-miR-490-3p	CLIP-seq
MIRT2551347	hsa-miR-495	CLIP-seq
MIRT1064895	hsa-miR-499a-5p	CLIP-seq
MIRT2551352	hsa-miR-515-5p	CLIP-seq
MIRT2551356	hsa-miR-543	CLIP-seq
MIRT1064896	hsa-miR-548a-5p	CLIP-seq
MIRT1064897	hsa-miR-548ab	CLIP-seq
MIRT1064898	hsa-miR-548ak	CLIP-seq
MIRT1064899	hsa-miR-548b-5p	CLIP-seq
MIRT1064900	hsa-miR-548c-5p	CLIP-seq
MIRT1064901	hsa-miR-548d-5p	CLIP-seq
MIRT1064902	hsa-miR-548h	CLIP-seq
MIRT1064903	hsa-miR-548i	CLIP-seq
MIRT1064904	hsa-miR-548j	CLIP-seq
MIRT1064905	hsa-miR-548m	CLIP-seq
MIRT1064906	hsa-miR-548n	CLIP-seq
MIRT1064907	hsa-miR-548w	CLIP-seq
MIRT1064908	hsa-miR-548y	CLIP-seq
MIRT1064909	hsa-miR-559	CLIP-seq
MIRT2551362	hsa-miR-569	CLIP-seq
MIRT2551363	hsa-miR-570	CLIP-seq
MIRT2551364	hsa-miR-574-5p	CLIP-seq
MIRT2551368	hsa-miR-582-3p	CLIP-seq
MIRT2551370	hsa-miR-590-3p	CLIP-seq
MIRT2551371	hsa-miR-593	CLIP-seq
MIRT2551373	hsa-miR-641	CLIP-seq
MIRT2551374	hsa-miR-643	CLIP-seq
MIRT2551375	hsa-miR-645	CLIP-seq
MIRT2551379	hsa-miR-760	CLIP-seq
MIRT2015439	hsa-miR-761	CLIP-seq
MIRT2015440	hsa-miR-764	CLIP-seq
MIRT2551380	hsa-miR-765	CLIP-seq
MIRT2551381	hsa-miR-766	CLIP-seq
MIRT2551382	hsa-miR-767-3p	CLIP-seq
MIRT2551383	hsa-miR-873	CLIP-seq
MIRT2551385	hsa-miR-889	CLIP-seq
MIRT2451771	hsa-miR-890	CLIP-seq
MIRT2015441	hsa-miR-922	CLIP-seq

Show/Hide all(83)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	17185418
GO:0001819	Process	Positive regulation of cytokine production	IBA
GO:0002112	Function	Interleukin-33 receptor binding	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IEA
GO:0002282	Process	Microglial cell activation involved in immune response	IEA
GO:0002638	Process	Negative regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002686	Process	Negative regulation of leukocyte migration	IEA
GO:0002826	Process	Negative regulation of T-helper 1 type immune response	IEA
GO:0002830	Process	Positive regulation of type 2 immune response	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	19841166, 27830702
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	16286016, 18688256, 29045903
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	27830702
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IDA	18787100, 18836528, 21357533, 22215666
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	22215666
GO:0005737	Component	Cytoplasm	IEA
GO:0006606	Process	Protein import into nucleus	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0010186	Process	Positive regulation of cellular defense response	IEA
GO:0010186	Process	Positive regulation of cellular defense response	ISS
GO:0010467	Process	Gene expression	IEA
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	IEA
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	ISS
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0030133	Component	Transport vesicle	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032722	Process	Positive regulation of chemokine production	IDA	19841166
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032736	Process	Positive regulation of interleukin-13 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	11960013, 16286016, 17675517, 18802081, 20532808
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IEA
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IMP	31435003
GO:0038172	Process	Interleukin-33-mediated signaling pathway	ISS
GO:0042092	Process	Type 2 immune response	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IDA	19841166
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043032	Process	Positive regulation of macrophage activation	ISS
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	27830702
GO:0045345	Process	Positive regulation of MHC class I biosynthetic process	IEA
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS	19841166
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS	19841166
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	27830702
GO:0061518	Process	Microglial cell proliferation	IEA
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IEA
GO:0120042	Process	Negative regulation of macrophage proliferation	IEA
GO:0120042	Process	Negative regulation of macrophage proliferation	ISS
GO:0140367	Process	Antibacterial innate immune response	IEA
GO:0140367	Process	Antibacterial innate immune response	ISS
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	8654373

MIM	HGNC	e!Ensembl
608678	16028	ENSG00000137033

Protein

UniProt ID

O95760

Protein name

Interleukin-33 (IL-33) (Interleukin-1 family member 11) (IL-1F11) (Nuclear factor from high endothelial venules) (NF-HEV) [Cleaved into: Interleukin-33 (95-270); Interleukin-33 (99-270); Interleukin-33 (109-270)]

Protein function

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed:16286016, PubMed:19841166). Involved in the maturation of Th2 cells inducing the secretion

PDB

2KLL , 4KC3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15095	IL33	5 → 268	Interleukin 33	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at high level in high endothelial venules found in tonsils, Peyer patches and mesenteric lymph nodes. Almost undetectable in placenta. {ECO:0000269|PubMed:12819012}.

Sequence

MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYF
RRETTKRPSLKTGRKHKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPIT
EYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGK
MLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFI
GVKDNHLALIKVDSSENLCTENILFKLSET

Sequence length

270

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Necroptosis Cytosolic DNA-sensing pathway Influenza A		PIP3 activates AKT signaling Ub-specific processing proteases PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Interleukin-33 signaling

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma (age of onset), Asthma (time to onset), Asthma, Pediatric asthma, Asthma in any disease, Asthma (childhood onset), Nonatopic asthma, Atopic asthma, Asthma (adult onset), Asthma onset (childhood vs adult), Asthma (moderate or severe)	N/A	N/A	GWAS
Endometriosis	Endometriosis	N/A	N/A	GWAS
Nasal polyposis	Nasal polyps	N/A	N/A	GWAS
Sinusitis	Chronic sinusitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (259)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Associate	27026387
Abortion Habitual	Inhibit	27026387
Acute Coronary Syndrome	Stimulate	25591771
Adenocarcinoma	Associate	25324197
Adenocarcinoma	Inhibit	29499051
Adenocarcinoma of Lung	Associate	29499051
Adenoma	Associate	25324197
Airway Obstruction	Associate	33486314
Allergic Fungal Sinusitis	Associate	20338108, 23805875, 25932636, 26047816, 28199345
Allergic Fungal Sinusitis	Stimulate	35752781
Alzheimer Disease	Associate	21368376, 32678011, 36793992, 36835494
Ameloblastoma	Associate	31990904
Amyloidosis Hereditary Transthyretin Related	Stimulate	31253122
Anaphylaxis	Associate	30544846
Aortic Valve Disease	Associate	37509127
Arthritis Juvenile	Associate	36550815
Arthritis Psoriatic	Associate	34177886, 34816685
Arthritis Psoriatic	Stimulate	34884710
Arthritis Rheumatoid	Associate	19439663, 20070408, 22246057, 23967327, 24106520, 24779919, 26571131, 29363647, 34177886
Arthritis Rheumatoid	Stimulate	26749303
Asthma	Associate	19439663, 19801525, 20860503, 22694930, 23541324, 24479526, 26119467, 26318341, 26762527, 27177148, 27432971, 27439200, 28176939, 28199345, 28262704 View all (24 more)
Asthma	Stimulate	26107423, 28275176, 31539147, 36685501
Asthma	Inhibit	28787443
Atherosclerosis	Associate	19439663, 24107076, 24886535, 26571131, 27142573, 29373608, 33669101
Atherosclerosis	Inhibit	31383884
Atrial Remodeling	Associate	29285671
Autoimmune Diseases	Associate	26343805, 27097949, 27579324, 28865413, 33838073, 36550815
Autoimmune Pancreatitis	Stimulate	32938972
Bantu siderosis	Stimulate	34083737
Barrett Esophagus	Associate	20029461
Behcet Syndrome	Stimulate	23960440
Behcet Syndrome	Associate	33859633
Blood Coagulation Disorders	Inhibit	27142573
Bone Diseases	Associate	35617338
Bone Resorption	Stimulate	20532808
Brain Ischemia	Inhibit	31142723
Breast Neoplasms	Stimulate	26456994
Breast Neoplasms	Associate	36766731, 37247282, 38003516
Bronchiolitis	Stimulate	32628310, 33514798
Bronchiolitis	Associate	36137923, 36685501
Bronchiolitis Obliterans Syndrome	Stimulate	26717145
Bronchiolitis Obliterans Syndrome	Associate	37003354, 37014805
Bronchitis Chronic	Associate	28176939
Carcinogenesis	Associate	35409061
Carcinoma Hepatocellular	Associate	33062675, 38097352
Carcinoma Merkel Cell	Associate	35409061
Carcinoma Ovarian Epithelial	Stimulate	26433471
Carcinoma Renal Cell	Associate	26926076, 29736154
Carcinoma Squamous Cell	Inhibit	29499051
Cardiomyopathy Dilated	Associate	26437894
Cardiovascular Diseases	Associate	19439663, 31316160, 38213254
Carotid Stenosis	Associate	27142573, 28637660
Celiac Disease	Stimulate	26343805
Cerebral Infarction	Associate	24107076
Chronic Disease	Associate	33837219
Chronic Urticaria	Stimulate	39769469
Cognition Disorders	Associate	32678011
Cognitive Dysfunction	Associate	29196629, 32678011
Colitis	Associate	23634226
Colitis Ulcerative	Associate	23634226, 28860510, 31824476, 31918598
Colitis Ulcerative	Stimulate	26884875, 27748438, 35798804
Colorectal Neoplasms	Associate	25324197, 29040430
Communication Disorders	Associate	32564053
Conjunctivitis Allergic	Associate	36580308
Conversion Disorder	Associate	29453280
Coronary Artery Disease	Associate	24075188, 25517029, 28045954, 30123216, 34928757
Coronary Artery Disease	Stimulate	26749303
Coronary Disease	Associate	25517029
COVID 19	Associate	32962703, 33837219, 34723226, 34928757, 35334213, 37679779
COVID 19	Stimulate	37174682
Crohn Disease	Associate	23634226
Cystic Fibrosis	Associate	35738281
Death	Associate	36248807
Dermatitis	Associate	30544846
Dermatitis Allergic Contact	Associate	26357000
Dermatitis Atopic	Associate	22272250, 24851948, 31596431, 32044300, 33865911, 34070943, 34293350, 35065132, 35663970
Dermatitis Atopic	Stimulate	26107423, 27868148
Dermatitis Atopic 1	Stimulate	23000728
Dermatitis Atopic 1	Associate	30257479, 33453290
Diabetes Gestational	Inhibit	31880859
Diabetes Gestational	Associate	34235813
Diabetes Mellitus	Associate	34566972
Diabetes Mellitus Type 1	Associate	27761063
Diabetes Mellitus Type 2	Associate	28045954, 31073344
Diabetes Mellitus Type 2	Stimulate	35801423, 36368230
Drug Hypersensitivity	Associate	23000728, 23439564, 24851948, 26762527, 27579324, 29691411, 30257479, 30303258, 30544846, 30735685, 33662368, 34928757, 35035826, 35368043
Drug Hypersensitivity	Stimulate	36685501
Drug Resistant Epilepsy	Associate	29453280
Dry Eye Syndromes	Associate	29283120, 31673224
Eczema	Associate	31596431
Endometrial Neoplasms	Associate	40138919
Endometriosis	Associate	25031694
Eosinophilia	Associate	20029461, 26047816
Eosinophilia	Stimulate	29859068
Eosinophilic enteropathy	Associate	25234644
Eosinophilic Esophagitis	Stimulate	29242581
Epidermal Cyst	Associate	33683743
Esophageal Squamous Cell Carcinoma	Associate	39307133
Essential Hypertension	Associate	40075282
Familial Primary Pulmonary Hypertension	Inhibit	25003325
Fatty Liver Alcoholic	Associate	39350187
Fibrosis	Associate	29285671, 31953139, 32977155, 34012433
Gastroesophageal Reflux	Associate	26986625
Gastroesophageal Reflux	Stimulate	34996831
Glioblastoma	Associate	31889095
Glioma	Associate	28849217, 31889095, 32003751
Glut1 Deficiency Syndrome	Associate	33865911, 34293350
Gout	Stimulate	27579324
Granulomatosis with Polyangiitis	Stimulate	33527387
Granulomatous Mastitis	Associate	37247282
Heart Diseases	Associate	35065132
Heart Failure	Associate	24385685, 31142723, 34342552
Hemolysis	Stimulate	26107423
Hepatitis Alcoholic	Associate	31953139
Hepatitis B Chronic	Associate	35801423
Hepatitis B Chronic	Stimulate	37995395
Hepatitis C Chronic	Stimulate	26107423
HIV Infections	Stimulate	30564243
Hyaline Membrane Disease	Associate	26437894
Hypereosinophilic Syndrome	Associate	35752781
Hypertension	Associate	38255771
Hypertriglyceridemia	Associate	38255771
Hypertrophy	Associate	20029461
Hypoxia	Associate	37481543
Immune System Diseases	Associate	33859633
Immunoglobulin G4 Related Disease	Associate	28205524, 32938972
Infections	Associate	18836528, 19439663, 31320834, 36366528, 37239461, 39591475
Infections	Stimulate	26318341
Infertility	Associate	37972259, 39580416
Infertility Female	Associate	39580416
Inflammation	Associate	17725714, 18955562, 19439663, 19801525, 20029461, 20070408, 20338108, 20926795, 22246057, 22272250, 22708120, 23039129, 23439564, 23634226, 23967327 View all (80 more)
Inflammation	Inhibit	24886535, 31880859, 34012433
Inflammation	Stimulate	26762527, 27045377, 31918598, 33792188, 37029363, 38497670
Inflammatory Bowel Diseases	Associate	23634226, 26884875, 34928757
Insulin Resistance	Associate	24886535, 31073344
Insulin Resistance	Stimulate	36368230
Intracranial Aneurysm	Associate	36248807
Kidney Diseases	Inhibit	27579324
Laboratory Infection	Associate	29490771
Leukemia	Associate	33324412
Leukemia Eosinophilic Acute	Stimulate	23000728
Leukemia Myeloid Acute	Associate	33324412
Leukemic Infiltration	Associate	33486314
Lichen Planus	Stimulate	31792433
Liver Cirrhosis	Associate	26095613
Liver Diseases Alcoholic	Inhibit	30478965
Liver Diseases Alcoholic	Associate	31953139
Lung Diseases	Associate	29499051, 34928757
Lung Diseases Obstructive	Associate	29319364
Lung Injury	Associate	26437894
Lung Neoplasms	Associate	29499051, 34671675
Lupus Erythematosus Systemic	Associate	27097949, 28320468, 30984790, 36550815
Malaria	Associate	26437894
Malformations of Cortical Development Group I	Inhibit	34435521
Mast Cell Activation Disorders	Stimulate	33882986
Melanoma	Associate	35669782
Metabolic Diseases	Associate	24886535
Metabolic Syndrome	Stimulate	38255771
Microcephaly	Associate	30121258
Microcephaly	Stimulate	30199767
Microphthalmia Syndromic 10	Stimulate	39294186
Mitral Valve Prolapse Myxomatous 2	Associate	33669101
Mucocutaneous Lymph Node Syndrome	Associate	37166618
Multiple Sclerosis	Stimulate	22189043, 28865413, 39294186
Multiple Sclerosis	Associate	30562364, 36604748
Multiple Sclerosis Relapsing Remitting	Associate	30562364
Mycosis Fungoides	Associate	34928757
Myocardial Infarction	Associate	28623858, 34342552
Nasal Polyps	Associate	20338108, 23805875, 24574111, 26684290, 29768034, 35752781, 36840497
Nasal Polyps	Stimulate	32085629
Nasopharyngeal Carcinoma	Associate	31770211
Necrosis	Associate	20070408, 30935248
Neoplasm Metastasis	Associate	26433471
Neoplasms	Associate	18836528, 25324197, 26456994, 28765940, 28849217, 29499051, 29736154, 31396219, 31659258, 31889095, 31990904, 32003751, 32312946, 33062675, 33420223 View all (10 more)
Neoplasms	Inhibit	28000059, 40065365
Neoplasms Adipose Tissue	Associate	24886535
Nerve Degeneration	Associate	33669101
Neurodegenerative Diseases	Associate	22246057
Neutrophilia Hereditary	Stimulate	38497670
Nose Diseases	Associate	35752781
Obesity	Associate	24886535, 28045954, 31073344, 32101157, 36368230, 38213254
Osteoarthritis	Associate	35565085
Osteosarcoma	Associate	29210060, 32312946
Ovarian Diseases	Associate	34247803
Ovarian Neoplasms	Associate	26433471
Pancreatic Neoplasms	Associate	35658010
Pancreatitis	Associate	35738281
Papillomavirus Infections	Inhibit	30935248
Parkinson Disease	Inhibit	38485911
Periapical Granuloma	Associate	25141207
Periapical Periodontitis	Associate	31218936
Periodontitis	Associate	28320468, 36947565
Peritonitis	Stimulate	31659258
Phenylketonurias	Associate	25003325
Placenta Accreta	Associate	38255950
Plaque Atherosclerotic	Associate	28637660
Plasma Cell Granuloma Pulmonary	Associate	35238669
Pleural Effusion	Associate	39809152
Pneumonia	Associate	31137813, 32564053
Polyposis Syndrome Hereditary Mixed 1	Associate	25324197
Polyps	Associate	20338108, 24574111, 26684290
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	20070408
Pre Eclampsia	Associate	21949719
Pre Eclampsia	Inhibit	29736154
Prediabetic State	Associate	37762140
Pregnancy Complications	Associate	37972259
Primary Myelofibrosis	Stimulate	29776986
Progressive Transformation of Germinal Centers	Associate	28205524
Protoporphyria Erythropoietic	Inhibit	40138919
Pruritus	Associate	31596431, 36272417
Psoriasis	Stimulate	34816685
Psoriasis	Associate	34884710, 35663970
Pulmonary Disease Chronic Obstructive	Stimulate	25595648, 29859068
Pulmonary Disease Chronic Obstructive	Associate	28176939, 29319364, 31364132, 32017227, 32842623, 33292049, 33486314, 33722239, 33837219, 34354706, 37442582
Pulmonary Edema	Stimulate	26437894
Pulmonary Eosinophilia	Associate	23000728
Pulmonary Fibrosis	Associate	35238669
Renal Insufficiency Chronic	Associate	28614418
Respiratory Distress Syndrome	Associate	40118005
Respiratory Hypersensitivity	Associate	36907566
Respiratory Insufficiency	Associate	30257479
Respiratory Sounds	Associate	30544846
Respiratory Sounds	Stimulate	32628310
Respiratory Syncytial Virus Infections	Stimulate	36036806
Respiratory Tract Infections	Associate	33837219, 36036806
Retinal Degeneration	Associate	35334213
Rhinitis Allergic	Associate	28787443, 34653730, 35035826
Rhinitis Allergic	Inhibit	28787443
Sarcoidosis	Associate	24768588
Sarcoma	Inhibit	29896199
Sepsis	Associate	27579324, 31953139
Severe Acute Respiratory Syndrome	Associate	31953139
Shock	Stimulate	26437894
Sjogren's Syndrome	Associate	27097949
Skin Abnormalities	Associate	34293350
Skin Diseases	Associate	22673732, 24851948, 26357000, 30684550, 33865911
Smoke Inhalation Injury	Associate	28176939
Soft Tissue Injuries	Associate	19439663
Spondylitis Ankylosing	Associate	34928757
ST Elevation Myocardial Infarction	Associate	35880176
Status Asthmaticus	Associate	20926795, 26318341, 27177148, 27699235, 28262704, 29778524, 30174671, 35986608
Status Asthmaticus	Stimulate	29453280
Stomach Diseases	Associate	31320834
Stomach Neoplasms	Stimulate	24741632, 31659258
Stomach Neoplasms	Associate	27074834, 28000059, 33760194, 34071419, 34895039
Tendinopathy	Associate	29385715
Thrombosis	Associate	27142573, 33669101
Toxoplasmosis	Associate	36883147
Trauma Nervous System	Associate	23840697
Tuberculosis	Associate	23486418
Tuberculosis Meningeal	Stimulate	38035159
Tuberculosis Meningeal	Associate	39809152
Ulcer	Associate	28000059
Uterine Cervicitis	Associate	30935248
Vascular Diseases	Associate	28614418
Vascular Remodeling	Associate	25003325, 31316160, 31947646
Vasculitis	Associate	32286393, 34373564
Virus Diseases	Associate	34928757
Wounds and Injuries	Associate	19439663

IL33 (interleukin 33)