XKRY (XK related, Y-linked (pseudogene))

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 9082
Gene name XK related, Y-linked (pseudogene)
Gene symbol XKRY
Synonyms (NCBI Gene)
XKRY1
Chromosome Y
Chromosome location Yq11.222
Summary This probable pseudogene is located in the nonrecombining portion of the Y chromosome, and is expressed specifically in testis. It is similar to the XK (X-linked Kell blood group precursor) gene, which encodes a putative membrane transport protein. This g
miRNA miRNA information provided by mirtarbase database.
8
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (8)
miRTarBase ID miRNA Experiments Reference
MIRT2149355 hsa-miR-103a CLIP-seq
MIRT2149356 hsa-miR-107 CLIP-seq
MIRT2149357 hsa-miR-4661-5p CLIP-seq
MIRT2149358 hsa-miR-885-3p CLIP-seq
MIRT2369819 hsa-miR-514 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (2)
GO ID Ontology Definition Evidence Reference
GO:0007338 Process Single fertilization TAS 9381176
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
400015 18571 ENSG00000290724
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14609
Protein name Testis-specific XK-related protein, Y-linked
Family and domains
Tissue specificity TISSUE SPECIFICITY: Testis specific.
Sequence 
MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV
TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKIIPAWWVSMDAYLNHA
SICCHQFSCLSAVKLQLSNEELIRDTRWDIQSYTTDFSF
Sequence length 159
Interactions View interactions