Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9082
Gene name Gene Name - the full gene name approved by the HGNC.
XK related, Y-linked (pseudogene)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
XKRY
Synonyms (NCBI Gene) Gene synonyms aliases
XKRY1
Chromosome Chromosome number
Y
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Yq11.222
Summary Summary of gene provided in NCBI Entrez Gene.
This probable pseudogene is located in the nonrecombining portion of the Y chromosome, and is expressed specifically in testis. It is similar to the XK (X-linked Kell blood group precursor) gene, which encodes a putative membrane transport protein. This g
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT2149355 hsa-miR-103a CLIP-seq
MIRT2149356 hsa-miR-107 CLIP-seq
MIRT2149357 hsa-miR-4661-5p CLIP-seq
MIRT2149358 hsa-miR-885-3p CLIP-seq
MIRT2369819 hsa-miR-514 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0007338 Process Single fertilization TAS 9381176
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
400015 18571 ENSG00000290724
Protein
UniProt ID O14609
Protein name Testis-specific XK-related protein, Y-linked
Family and domains
Tissue specificity TISSUE SPECIFICITY: Testis specific.
Sequence
MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV
TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKIIPAWWVSMDAYLNHA
SICCHQFSCLSAVKLQLSNEELIRDTRWDIQSYTTDFSF
Sequence length 159
Interactions View interactions
<