PRY (PTPN13 like Y-linked)

Gene Gene information from NCBI Gene database.
Gene miRNA Other IDs Protein
Entrez ID 9081
Gene name PTPN13 like Y-linked
Gene symbol PRY
Synonyms (NCBI Gene)
PRY1PTPN13LY
Chromosome Y
Chromosome location Yq11.223
Summary This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. It encodes a protein which has a low degree of similarity to protein tyrosine phosphatase, non-receptor type 13. Two nearly identical copies of t
miRNA miRNA information provided by mirtarbase database.
46
Gene miRNA Other IDs Protein
Show/Hide all (46)
miRTarBase ID miRNA Experiments Reference
MIRT029451 hsa-miR-26b-5p Microarray 19088304
MIRT695154 hsa-miR-504-5p HITS-CLIP 23313552
MIRT695153 hsa-miR-29a-3p HITS-CLIP 23313552
MIRT695152 hsa-miR-29b-3p HITS-CLIP 23313552
MIRT695151 hsa-miR-29c-3p HITS-CLIP 23313552
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Other IDs Protein
MIM HGNC e!Ensembl
400019 14024 ENSG00000235059
Protein Protein information from UniProt database.
Gene miRNA Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14603
Protein name PTPN13-like protein, Y-linked (Testis-specific PTP-BL-related Y protein)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in testis. Detected in spermatocytes, spermatids and spermatozoa (at protein level). {ECO:0000269|PubMed:11420382, ECO:0000269|PubMed:14665702}.
Sequence 
MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFL
WRYGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQ
SFLLRTLERGRGFRALGDICGHVHEED
Sequence length 147
Interactions View interactions