PRY (PTPN13 like Y-linked)

Gene
Gene miRNA Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9081
Gene name Gene Name - the full gene name approved by the HGNC.
PTPN13 like Y-linked
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRY
Synonyms (NCBI Gene) Gene synonyms aliases
PRY1, PTPN13LY
Chromosome Chromosome number
Y
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Yq11.223
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. It encodes a protein which has a low degree of similarity to protein tyrosine phosphatase, non-receptor type 13. Two nearly identical copies of t
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Other IDs Protein
Show/Hide all(46)
miRTarBase ID miRNA Experiments Reference
MIRT029451 hsa-miR-26b-5p Microarray 19088304
MIRT695154 hsa-miR-504-5p HITS-CLIP 23313552
MIRT695153 hsa-miR-29a-3p HITS-CLIP 23313552
MIRT695152 hsa-miR-29b-3p HITS-CLIP 23313552
MIRT695151 hsa-miR-29c-3p HITS-CLIP 23313552
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Other IDs Protein
MIM HGNC e!Ensembl
400019 14024 ENSG00000235059
Protein
Gene miRNA Other IDs Protein
UniProt ID O14603
Protein name PTPN13-like protein, Y-linked (Testis-specific PTP-BL-related Y protein)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in testis. Detected in spermatocytes, spermatids and spermatozoa (at protein level). {ECO:0000269|PubMed:11420382, ECO:0000269|PubMed:14665702}.
Sequence 
MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFL
WRYGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQ
SFLLRTLERGRGFRALGDICGHVHEED
Sequence length 147
Interactions View interactions
<