LDB2 (LIM domain binding 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 9079
Gene name LIM domain binding 2
Gene symbol LDB2
Synonyms (NCBI Gene)
CLIM1LDB-2LDB1
Chromosome 4
Chromosome location 4p15.32
Summary The protein encoded by this gene belongs to the LIM-domain binding family. Members of this family are characterized by a conserved nuclear localization sequence, an amino-terminal homodimerization domain and a carboxy-terminal LIM interaction domain. Thes
miRNA miRNA information provided by mirtarbase database.
134
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (134)
miRTarBase ID miRNA Experiments Reference
MIRT030241 hsa-miR-26b-5p Microarray 19088304
MIRT609694 hsa-miR-3169 HITS-CLIP 23824327
MIRT609693 hsa-miR-4515 HITS-CLIP 23824327
MIRT609692 hsa-miR-7154-3p HITS-CLIP 23824327
MIRT609694 hsa-miR-3169 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (26)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0001942 Process Hair follicle development IEA
GO:0003712 Function Transcription coregulator activity IBA
GO:0003712 Function Transcription coregulator activity TAS 9880598
GO:0005515 Function Protein binding IPI 15231748, 18330356, 20211142, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
603450 6533 ENSG00000169744
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43679
Protein name LIM domain-binding protein 2 (LDB-2) (Carboxyl-terminal LIM domain-binding protein 1) (CLIM-1) (LIM domain-binding factor CLIM1)
Protein function Transcription cofactor. Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01803 LIM_bind 30 → 186 LIM-domain binding protein Family
PF01803 LIM_bind 175 → 232 LIM-domain binding protein Family
PF17916 LID 298 → 326 LIM interaction domain (LID) Domain
Sequence 
MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFE
DDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDC
DQCTMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSILAMHAQD
PQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQKWQ
RMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVM
VVGEPTLMGGEFGDEDERLITRLENTQYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQ
ETKSENPPPQASQ
Sequence length 373
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs2477150423 RCV004557773
Show/Hide Text Mining Associations (9)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32196072
Adenoma Associate 37794510
Colorectal Neoplasms Associate 37794510
Glaucoma Associate 33114701
Hand Foot and Mouth Disease Associate 32634583
Lung Neoplasms Inhibit 36473369
Neoplasm Metastasis Stimulate 36473369
Neoplasms Associate 15967107
Small Cell Lung Carcinoma Associate 35845940