Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9079
Gene name Gene Name - the full gene name approved by the HGNC.
LIM domain binding 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LDB2
Synonyms (NCBI Gene) Gene synonyms aliases
CLIM1, LDB-2, LDB1
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.32
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the LIM-domain binding family. Members of this family are characterized by a conserved nuclear localization sequence, an amino-terminal homodimerization domain and a carboxy-terminal LIM interaction domain. Thes
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030241 hsa-miR-26b-5p Microarray 19088304
MIRT609694 hsa-miR-3169 HITS-CLIP 23824327
MIRT609693 hsa-miR-4515 HITS-CLIP 23824327
MIRT609692 hsa-miR-7154-3p HITS-CLIP 23824327
MIRT609694 hsa-miR-3169 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0001942 Process Hair follicle development IEA
GO:0003712 Function Transcription coregulator activity IBA
GO:0003712 Function Transcription coregulator activity TAS 9880598
GO:0005515 Function Protein binding IPI 15231748, 18330356, 20211142, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603450 6533 ENSG00000169744
Protein
UniProt ID O43679
Protein name LIM domain-binding protein 2 (LDB-2) (Carboxyl-terminal LIM domain-binding protein 1) (CLIM-1) (LIM domain-binding factor CLIM1)
Protein function Transcription cofactor. Binds to the LIM domain of a wide variety of LIM domain-containing transcription factors.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01803 LIM_bind 30 186 LIM-domain binding protein Family
PF01803 LIM_bind 175 232 LIM-domain binding protein Family
PF17916 LID 298 326 LIM interaction domain (LID) Domain
Sequence
MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFE
DDATLTLSFCLEDGPKRYTIGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDC
DQCTMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTWHFTIRQYRELVPRSIL
AMHAQD
PQVLDQ
LSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLK
TCLFQKWQ
RMVAPPAEPTRQPTTKRRKRKNSTSSTSNSSAGNNANSTGSKKKTTAANLSLSSQVPDVM
VVGEPTLMGGEFGDEDERLITRLENT
QYDAANGMDDEEDFNNSPALGNNSPWNSKPPATQ
ETKSENPPPQASQ
Sequence length 373
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer specific mortality in estrogen receptor negative breast cancer N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32196072
Adenoma Associate 37794510
Colorectal Neoplasms Associate 37794510
Glaucoma Associate 33114701
Hand Foot and Mouth Disease Associate 32634583
Lung Neoplasms Inhibit 36473369
Neoplasm Metastasis Stimulate 36473369
Neoplasms Associate 15967107
Small Cell Lung Carcinoma Associate 35845940