DIRAS3 (DIRAS family GTPase 3)

Gene

• Entrez ID: 9077
• Gene name: DIRAS family GTPase 3
• Gene symbol: DIRAS3
• Synonyms (NCBI Gene): ARHI, NOEY2
• Chromosome: 1
• Chromosome location: 1p31.3
• Summary: This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in ma

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006018	hsa-miR-221-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21071579
MIRT006019	hsa-miR-222-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21071579
MIRT006018	hsa-miR-221-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21071579
MIRT006019	hsa-miR-222-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21071579
MIRT006018	hsa-miR-221-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21071579
MIRT006019	hsa-miR-222-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21071579
MIRT006018	hsa-miR-221-3p	Flow, Luciferase reporter assay, qRT-PCR	23801152
MIRT937035	hsa-miR-149	CLIP-seq
MIRT937036	hsa-miR-4297	CLIP-seq
MIRT937037	hsa-miR-4476	CLIP-seq
MIRT937038	hsa-miR-4487	CLIP-seq
MIRT937039	hsa-miR-4700-3p	CLIP-seq
MIRT937040	hsa-miR-760	CLIP-seq
MIRT937035	hsa-miR-149	CLIP-seq
MIRT937037	hsa-miR-4476	CLIP-seq
MIRT937038	hsa-miR-4487	CLIP-seq
MIRT937039	hsa-miR-4700-3p	CLIP-seq
MIRT937040	hsa-miR-760	CLIP-seq
MIRT937035	hsa-miR-149	CLIP-seq
MIRT937037	hsa-miR-4476	CLIP-seq
MIRT937038	hsa-miR-4487	CLIP-seq
MIRT937039	hsa-miR-4700-3p	CLIP-seq
MIRT937040	hsa-miR-760	CLIP-seq
MIRT2516540	hsa-miR-188-3p	CLIP-seq
MIRT2516541	hsa-miR-3140-3p	CLIP-seq
MIRT2516542	hsa-miR-3611	CLIP-seq
MIRT2516543	hsa-miR-4768-5p	CLIP-seq
MIRT2516544	hsa-miR-513b	CLIP-seq
MIRT2516545	hsa-miR-532-3p	CLIP-seq
MIRT2516546	hsa-miR-570	CLIP-seq
MIRT2516547	hsa-miR-579	CLIP-seq
MIRT2516548	hsa-miR-664	CLIP-seq
MIRT2516549	hsa-miR-767-3p	CLIP-seq
MIRT2516540	hsa-miR-188-3p	CLIP-seq
MIRT937039	hsa-miR-4700-3p	CLIP-seq
MIRT2679279	hsa-miR-4731-3p	CLIP-seq
MIRT2516543	hsa-miR-4768-5p	CLIP-seq
MIRT2679280	hsa-miR-4801	CLIP-seq
MIRT2679281	hsa-miR-5095	CLIP-seq
MIRT2516544	hsa-miR-513b	CLIP-seq
MIRT2516545	hsa-miR-532-3p	CLIP-seq
MIRT2679282	hsa-miR-600	CLIP-seq
MIRT2516548	hsa-miR-664	CLIP-seq
MIRT2516549	hsa-miR-767-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Repression	16158053;16638845;16757345;17230502
E2F4	Repression	16158053;16638845;16757345;17230502
HDAC9	Repression	16158053
STAT3	Unknown	23604529

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	9874798
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	21643014, 32296183
GO:0005525	Function	GTP binding	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0006349	Process	Regulation of gene expression by genetic imprinting	TAS	9874798
GO:0007264	Process	Small GTPase mediated signal transduction	TAS	9874798
GO:0019003	Function	GDP binding	IBA	21873635

Other IDs

• MIM: 605193
• HGNC: 687
• e!Ensembl: ENSG00000162595

Protein

• UniProt ID: O95661
• Protein name: GTP-binding protein Di-Ras3 (Distinct subgroup of the Ras family member 3) (Rho-related GTP-binding protein RhoI)
• PDB: 6NAZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	39 → 201	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.
• Sequence:

  MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASG
  NFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTK
  KETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEI
  SAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

• Sequence length: 229