Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	9077
Gene name	DIRAS family GTPase 3
Gene symbol	DIRAS3
Synonyms (NCBI Gene)	ARHINOEY2
Chromosome	1
Chromosome location	1p31.3
Summary	This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in ma

Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006018	hsa-miR-221-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21071579
MIRT006019	hsa-miR-222-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21071579
MIRT006018	hsa-miR-221-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21071579
MIRT006019	hsa-miR-222-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21071579
MIRT006018	hsa-miR-221-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21071579
MIRT006019	hsa-miR-222-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21071579
MIRT006018	hsa-miR-221-3p	FlowLuciferase reporter assayqRT-PCR	23801152
MIRT937035	hsa-miR-149	CLIP-seq
MIRT937036	hsa-miR-4297	CLIP-seq
MIRT937037	hsa-miR-4476	CLIP-seq
MIRT937038	hsa-miR-4487	CLIP-seq
MIRT937039	hsa-miR-4700-3p	CLIP-seq
MIRT937040	hsa-miR-760	CLIP-seq
MIRT937035	hsa-miR-149	CLIP-seq
MIRT937037	hsa-miR-4476	CLIP-seq
MIRT937038	hsa-miR-4487	CLIP-seq
MIRT937039	hsa-miR-4700-3p	CLIP-seq
MIRT937040	hsa-miR-760	CLIP-seq
MIRT937035	hsa-miR-149	CLIP-seq
MIRT937037	hsa-miR-4476	CLIP-seq
MIRT937038	hsa-miR-4487	CLIP-seq
MIRT937039	hsa-miR-4700-3p	CLIP-seq
MIRT937040	hsa-miR-760	CLIP-seq
MIRT2516540	hsa-miR-188-3p	CLIP-seq
MIRT2516541	hsa-miR-3140-3p	CLIP-seq
MIRT2516542	hsa-miR-3611	CLIP-seq
MIRT2516543	hsa-miR-4768-5p	CLIP-seq
MIRT2516544	hsa-miR-513b	CLIP-seq
MIRT2516545	hsa-miR-532-3p	CLIP-seq
MIRT2516546	hsa-miR-570	CLIP-seq
MIRT2516547	hsa-miR-579	CLIP-seq
MIRT2516548	hsa-miR-664	CLIP-seq
MIRT2516549	hsa-miR-767-3p	CLIP-seq
MIRT2516540	hsa-miR-188-3p	CLIP-seq
MIRT937039	hsa-miR-4700-3p	CLIP-seq
MIRT2679279	hsa-miR-4731-3p	CLIP-seq
MIRT2516543	hsa-miR-4768-5p	CLIP-seq
MIRT2679280	hsa-miR-4801	CLIP-seq
MIRT2679281	hsa-miR-5095	CLIP-seq
MIRT2516544	hsa-miR-513b	CLIP-seq
MIRT2516545	hsa-miR-532-3p	CLIP-seq
MIRT2679282	hsa-miR-600	CLIP-seq
MIRT2516548	hsa-miR-664	CLIP-seq
MIRT2516549	hsa-miR-767-3p	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
E2F1	Repression	16158053;16638845;16757345;17230502
E2F4	Repression	16158053;16638845;16757345;17230502
HDAC9	Repression	16158053
STAT3	Unknown	23604529

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	9874798
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	9874798
GO:0005515	Function	Protein binding	IPI	21643014, 32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	TAS	9874798
GO:0016020	Component	Membrane	IEA
GO:0019003	Function	GDP binding	IBA
GO:0071514	Process	Genomic imprinting	TAS	9874798

MIM	HGNC	e!Ensembl
605193	687	ENSG00000162595

O95661

Protein name

GTP-binding protein Di-Ras3 (Distinct subgroup of the Ras family member 3) (Rho-related GTP-binding protein RhoI)

PDB

6NAZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	39 → 201	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers.

Sequence

MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASG
NFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTK
KETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEI
SAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM

Sequence length

229

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
DIRAS3-related disorder	Likely benign	rs554165010	RCV003901973

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	19482475, 25560175, 9874798
Breast Neoplasms	Inhibit	23801152, 23871723
Carcinoma Non Small Cell Lung	Associate	35170376
Carcinoma Ovarian Epithelial	Associate	36805591
Carcinoma Pancreatic Ductal	Associate	38169324
Endometriosis	Associate	37598541
Esophageal Squamous Cell Carcinoma	Associate	35611939
Glioblastoma	Associate	32065482
Glioma	Associate	40649981
Growth Disorders	Associate	30916492
Hereditary Breast and Ovarian Cancer Syndrome	Associate	17401457, 19482475, 9874798
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	19435463, 29192415
Lung Neoplasms	Inhibit	35170376
Multiple Myeloma	Associate	19690192
Necrosis	Stimulate	26247722
Neoplasms	Associate	16207477, 24769729, 25560175, 27685841, 30540703, 40649981
Neoplasms	Inhibit	17401457, 17764565, 19435463, 21071579, 21643014, 22117988, 23801152, 24879154, 29192415, 30916492, 35170376, 38169324, 9874798
Non functioning pancreatic endocrine tumor	Associate	17401457
Osteosarcoma	Associate	27685841
Ovarian Neoplasms	Inhibit	18286529, 21643014, 26247722
Ovarian Neoplasms	Associate	24662131, 24769729, 24879154, 29504523
Personality Disorders	Associate	31570425
Prostatic Neoplasms	Inhibit	21071579, 22117988
Thyroid cancer follicular	Associate	38203733
Thyroid Cancer Papillary	Associate	38203733
Thyroid Diseases	Associate	38203733
Thyroid Neoplasms	Associate	38203733
Thyroid Nodule	Associate	31411490
Uterine Neoplasms	Associate	15785748
Weight Loss	Associate	28316325
X Linked Combined Immunodeficiency Diseases	Associate	28316325

DIRAS3 (DIRAS family GTPase 3)