SEC11C (SEC11 homolog C, signal peptidase complex subunit)

Gene

• Entrez ID: 90701
• Gene name: SEC11 homolog C, signal peptidase complex subunit
• Gene symbol: SEC11C
• Synonyms (NCBI Gene): SEC11L3, SPC21, SPCS4C
• Chromosome: 18
• Chromosome location: 18q21.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005192	hsa-miR-30a-5p	pSILAC	18668040
MIRT023588	hsa-miR-1-3p	Proteomics	18668040
MIRT005192	hsa-miR-30a-5p	Proteomics	18668040

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IDA	34388369
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781, 34388369
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005787	Component	Signal peptidase complex	IBA
GO:0005787	Component	Signal peptidase complex	IDA	34388369
GO:0005787	Component	Signal peptidase complex	IEA
GO:0005787	Component	Signal peptidase complex	IPI	34388369
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	34388369
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006465	Process	Signal peptide processing	IBA
GO:0006465	Process	Signal peptide processing	IDA	34388369
GO:0006465	Process	Signal peptide processing	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IBA
GO:0008233	Function	Peptidase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9BY50
• Protein name: Signal peptidase complex catalytic subunit SEC11C (EC 3.4.21.89) (Microsomal signal peptidase 21 kDa subunit) (SPase 21 kDa subunit) (SEC11 homolog C) (SEC11-like protein 3) (SPC21)
• Protein function: Catalytic component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum (PubMed:34388369). Specifically clea
• PDB: 7P2Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00717	Peptidase_S24	32 → 155	Peptidase S24-like	Domain

• Sequence:

  MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESP
  IVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGD
  IKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLA
  VMGAYVLLKRES

• Sequence length: 192

Pathways

KEGG:

Protein export

Reactome:

Synthesis, secretion, and deacylation of Ghrelin

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC DUCTAL ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROLIFERATIVE DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	36275477	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Inhibit	17242705	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	17242705, 36275477	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	37624966	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	35653344	★☆☆☆☆ Found in Text Mining only