Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9070
Gene name Gene Name - the full gene name approved by the HGNC.
ASH2 like, histone lysine methyltransferase complex subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ASH2L
Synonyms (NCBI Gene) Gene synonyms aliases
ASH2, ASH2L1, ASH2L2, Bre2
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p11.23
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1060499744 A>G Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001383 hsa-miR-1-3p pSILAC 18668040
MIRT001383 hsa-miR-1-3p Proteomics;Other 18668040
MIRT038629 hsa-miR-125b-2-3p CLASH 23622248
MIRT036952 hsa-miR-877-3p CLASH 23622248
MIRT628737 hsa-miR-1253 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription cis-regulatory region binding IBA
GO:0000976 Function Transcription cis-regulatory region binding IDA 16603732
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 12482968, 12670868, 14992727, 16189514, 16603732, 16892064, 17178841, 17500065, 17925232, 17998332, 19047629, 19131338, 19187761, 19433796, 19556245, 20085832, 21220120, 21516116, 22722839, 23414517, 23870121, 23995757, 24981860, 25416956, 25456412, 26886794, 31485071, 31515488, 322
GO:0005634 Component Nucleus IDA 15199122, 17500065, 18245475
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604782 744 ENSG00000129691
Protein
UniProt ID Q9UBL3
Protein name Set1/Ash2 histone methyltransferase complex subunit ASH2 (ASH2-like protein)
Protein function Transcriptional regulator (PubMed:12670868). Component or associated component of some histone methyltransferase complexes which regulates transcription through recruitment of those complexes to gene promoters (PubMed:19131338). Component of the
PDB 3RSN , 3S32 , 3TOJ , 4RIQ , 4X8N , 4X8P , 5F6K , 5F6L , 6E2H , 6KIU , 6KIV , 6KIW , 6KIX , 6KIZ , 6PWV , 6W5I , 6W5M , 6W5N , 7BRE , 7MBM , 7MBN , 7UD5 , 7W67 , 7W6A , 7W6I , 7W6J , 7W6L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00622 SPRY 420 498 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes. {ECO:0000269|PubMed:10393421}.
Sequence
MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGY
GQGDVLGFYINLPEDTET
AKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSE
IIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWG
AVVEHTLADVLYHVETEVDGRRSPPWEP
Sequence length 628
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cushing syndrome   Formation of the beta-catenin:TCF transactivating complex
PKMTs methylate histone lysines
Deactivation of the beta-catenin transactivating complex
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
<