Gene Gene information from NCBI Gene database.
Entrez ID 9070
Gene name ASH2 like, histone lysine methyltransferase complex subunit
Gene symbol ASH2L
Synonyms (NCBI Gene)
ASH2ASH2L1ASH2L2Bre2
Chromosome 8
Chromosome location 8p11.23
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs1060499744 A>G Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
221
miRTarBase ID miRNA Experiments Reference
MIRT001383 hsa-miR-1-3p pSILAC 18668040
MIRT001383 hsa-miR-1-3p Proteomics;Other 18668040
MIRT038629 hsa-miR-125b-2-3p CLASH 23622248
MIRT036952 hsa-miR-877-3p CLASH 23622248
MIRT628737 hsa-miR-1253 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription cis-regulatory region binding IBA
GO:0000976 Function Transcription cis-regulatory region binding IDA 16603732
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 12482968, 12670868, 14992727, 16189514, 16603732, 16892064, 17178841, 17500065, 17925232, 17998332, 19047629, 19131338, 19187761, 19433796, 19556245, 20085832, 21220120, 21516116, 22722839, 23414517, 23870121, 23995757, 24981860, 25416956, 25456412, 26886794, 31485071, 31515488, 322
GO:0005634 Component Nucleus IDA 15199122, 17500065, 18245475
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604782 744 ENSG00000129691
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBL3
Protein name Set1/Ash2 histone methyltransferase complex subunit ASH2 (ASH2-like protein)
Protein function Transcriptional regulator (PubMed:12670868). Component or associated component of some histone methyltransferase complexes which regulates transcription through recruitment of those complexes to gene promoters (PubMed:19131338). Component of the
PDB 3RSN , 3S32 , 3TOJ , 4RIQ , 4X8N , 4X8P , 5F6K , 5F6L , 6E2H , 6KIU , 6KIV , 6KIW , 6KIX , 6KIZ , 6PWV , 6W5I , 6W5M , 6W5N , 7BRE , 7MBM , 7MBN , 7UD5 , 7W67 , 7W6A , 7W6I , 7W6J , 7W6L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00622 SPRY 420 498 SPRY domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes. {ECO:0000269|PubMed:10393421}.
Sequence
MAAAGAGPGQEAGAGPGPGAVANATGAEEGEMKPVAAGAAAPPGEGISAAPTVEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGY
GQGDVLGFYINLPEDTET
AKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSE
IIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWG
AVVEHTLADVLYHVETEVDGRRSPPWEP
Sequence length 628
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cushing syndrome   Formation of the beta-catenin:TCF transactivating complex
PKMTs methylate histone lysines
Deactivation of the beta-catenin transactivating complex
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Global developmental delay Likely pathogenic rs1060499744 RCV000454265
Intellectual disability Likely pathogenic rs1060499744 RCV000454265
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22433456
Glioblastoma Associate 37974198
Glioma Associate 25996283
Hematologic Neoplasms Associate 31251903
Hodgkin Disease Associate 33257682
Leukemia Biphenotypic Acute Associate 28633016
Leukemia Myeloid Acute Associate 28185526
Neoplasms Associate 28182322, 37974198
Testicular Neoplasms Associate 33257682