Gene Gene information from NCBI Gene database.
Entrez ID 9066
Gene name Synaptotagmin 7
Gene symbol SYT7
Synonyms (NCBI Gene)
IPCA-7IPCA7PCANAP7SYT-VIISYTVII
Chromosome 11
Chromosome location 11q12.2
Summary This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. A similar protein in rodents mediates hormone secretio
miRNA miRNA information provided by mirtarbase database.
674
miRTarBase ID miRNA Experiments Reference
MIRT621920 hsa-miR-614 HITS-CLIP 23824327
MIRT621919 hsa-miR-4707-5p HITS-CLIP 23824327
MIRT621918 hsa-miR-5587-3p HITS-CLIP 23824327
MIRT621917 hsa-miR-6887-3p HITS-CLIP 23824327
MIRT621916 hsa-miR-6795-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
69
GO ID Ontology Definition Evidence Reference
GO:0000149 Function SNARE binding IBA
GO:0000149 Function SNARE binding IEA
GO:0001778 Process Plasma membrane repair IEA
GO:0001778 Process Plasma membrane repair ISS
GO:0005509 Function Calcium ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604146 11514 ENSG00000011347
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43581
Protein name Synaptotagmin-7 (IPCA-7) (Prostate cancer-associated protein 7) (Synaptotagmin VII) (SytVII)
Protein function Ca(2+) sensor involved in Ca(2+)-dependent exocytosis of secretory and synaptic vesicles through Ca(2+) and phospholipid binding to the C2 domain (By similarity). Ca(2+) induces binding of the C2-domains to phospholipid membranes and to assemble
PDB 2D8K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00168 C2 150 257 C2 domain Domain
PF00168 C2 281 399 C2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a variety of adult and fetal tissues.
Sequence
MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPD
SGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSP
GSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLL
PDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSI
PLNKVDLTQMQTFWKDL
KPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGG
TSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDK
LSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWH
QLKA
Sequence length 403
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
HYPERTENSION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Breast Neoplasms Associate 33910530
★☆☆☆☆
Found in Text Mining only
Cognition Disorders Associate 31663645
★☆☆☆☆
Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder Associate 31663645
★☆☆☆☆
Found in Text Mining only
Lung Neoplasms Stimulate 30647108
★☆☆☆☆
Found in Text Mining only