Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
90637
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger AN1-type containing 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFAND2A
Synonyms (NCBI Gene) Gene synonyms aliases
AIRAP
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p22.3
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IEA
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610699 28073 ENSG00000178381
Protein
UniProt ID Q8N6M9
Protein name AN1-type zinc finger protein 2A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01428 zf-AN1 10 49 AN1-like Zinc finger Family
PF01428 zf-AN1 100 139 AN1-like Zinc finger Family
Sequence
MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLC
NTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHG
NFCIQHRHPLDHSCRHGSR
PTIKAG
Sequence length 145
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Leukemia Myeloid Associate 31540997
Melanoma Associate 31540997