ZFAND2A (zinc finger AN1-type containing 2A)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
90637
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger AN1-type containing 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFAND2A
Synonyms (NCBI Gene) Gene synonyms aliases
AIRAP
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p22.3
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610699 28073 ENSG00000178381
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8N6M9
Protein name AN1-type zinc finger protein 2A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01428 zf-AN1 10 → 49 AN1-like Zinc finger Family
PF01428 zf-AN1 100 → 139 AN1-like Zinc finger Family
Sequence 
MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLC
NTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHG
NFCIQHRHPLDHSCRHGSRPTIKAG
Sequence length 145
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Gout Gout GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Leukemia Myeloid Associate 31540997
Melanoma Associate 31540997