Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9063
Gene name	Protein inhibitor of activated STAT 2
Gene symbol	PIAS2
Synonyms (NCBI Gene)	ARIP3DIPMIZ1PIASXSIZ2ZMIZ4
Chromosome	18
Chromosome location	18q21.1
Summary	This gene encodes a member of the protein inhibitor of activated STAT family, which function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. Alternatively spliced transcript variants

Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029164	hsa-miR-26b-5p	Microarray	19088304
MIRT715734	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT715733	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT715732	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT715731	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT715730	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT715729	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT715728	hsa-miR-2116-3p	HITS-CLIP	19536157
MIRT715727	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT715726	hsa-miR-1976	HITS-CLIP	19536157
MIRT715725	hsa-miR-23a-5p	HITS-CLIP	19536157
MIRT715724	hsa-miR-23b-5p	HITS-CLIP	19536157
MIRT715723	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT715722	hsa-miR-4279	HITS-CLIP	19536157
MIRT715721	hsa-miR-498	HITS-CLIP	19536157
MIRT700794	hsa-miR-497-3p	HITS-CLIP	23313552
MIRT700793	hsa-miR-605-3p	HITS-CLIP	23313552
MIRT700792	hsa-miR-4493	HITS-CLIP	23313552
MIRT700791	hsa-miR-3140-3p	HITS-CLIP	23313552
MIRT700790	hsa-miR-6126	HITS-CLIP	23313552
MIRT448582	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT448581	hsa-miR-4720-3p	PAR-CLIP	22100165
MIRT448580	hsa-miR-3653-3p	PAR-CLIP	22100165
MIRT448579	hsa-miR-3658	PAR-CLIP	22100165
MIRT448582	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT448581	hsa-miR-4720-3p	PAR-CLIP	22100165
MIRT448580	hsa-miR-3653-3p	PAR-CLIP	22100165
MIRT448579	hsa-miR-3658	PAR-CLIP	22100165
MIRT715726	hsa-miR-1976	PAR-CLIP	27292025
MIRT715725	hsa-miR-23a-5p	PAR-CLIP	27292025
MIRT715724	hsa-miR-23b-5p	PAR-CLIP	27292025
MIRT715727	hsa-miR-3653-5p	PAR-CLIP	27292025
MIRT715722	hsa-miR-4279	PAR-CLIP	27292025
MIRT715734	hsa-miR-4722-3p	PAR-CLIP	27292025
MIRT715721	hsa-miR-498	PAR-CLIP	27292025
MIRT715733	hsa-miR-6727-3p	PAR-CLIP	27292025
MIRT715731	hsa-miR-6742-3p	PAR-CLIP	27292025
MIRT715732	hsa-miR-6747-3p	PAR-CLIP	27292025
MIRT715734	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT715733	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT715732	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT715731	hsa-miR-6742-3p	HITS-CLIP	19536157
MIRT715730	hsa-miR-150-5p	HITS-CLIP	19536157
MIRT715729	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT715728	hsa-miR-2116-3p	HITS-CLIP	19536157
MIRT715727	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT715726	hsa-miR-1976	HITS-CLIP	19536157
MIRT715725	hsa-miR-23a-5p	HITS-CLIP	19536157
MIRT715724	hsa-miR-23b-5p	HITS-CLIP	19536157
MIRT715723	hsa-miR-4713-5p	HITS-CLIP	19536157
MIRT715722	hsa-miR-4279	HITS-CLIP	19536157
MIRT715721	hsa-miR-498	HITS-CLIP	19536157
MIRT700794	hsa-miR-497-3p	HITS-CLIP	23313552
MIRT700793	hsa-miR-605-3p	HITS-CLIP	23313552
MIRT700792	hsa-miR-4493	HITS-CLIP	23313552
MIRT700791	hsa-miR-3140-3p	HITS-CLIP	23313552
MIRT700790	hsa-miR-6126	HITS-CLIP	23313552
MIRT448582	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT448581	hsa-miR-4720-3p	PAR-CLIP	22100165
MIRT448580	hsa-miR-3653-3p	PAR-CLIP	22100165
MIRT448579	hsa-miR-3658	PAR-CLIP	22100165
MIRT448582	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT448581	hsa-miR-4720-3p	PAR-CLIP	22100165
MIRT448580	hsa-miR-3653-3p	PAR-CLIP	22100165
MIRT448579	hsa-miR-3658	PAR-CLIP	22100165
MIRT2295673	hsa-miR-4277	CLIP-seq
MIRT2295674	hsa-miR-4502	CLIP-seq
MIRT2295675	hsa-miR-4762-3p	CLIP-seq
MIRT2295673	hsa-miR-4277	CLIP-seq
MIRT2295674	hsa-miR-4502	CLIP-seq
MIRT2295675	hsa-miR-4762-3p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	20408817
GO:0005515	Function	Protein binding	IPI	11477070, 14752048, 16154161, 16189514, 16204249, 19549727, 20936779, 21156324, 21516116, 21988832, 22210188, 22406621, 25416956, 25910212, 28842558, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	11477070, 14752048
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	16777850
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	9256341
GO:0016605	Component	PML body	IDA	22406621
GO:0016605	Component	PML body	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	IBA
GO:0016925	Process	Protein sumoylation	IDA	20408817, 22406621
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	EXP	12393906, 17283066, 18628979, 19041634, 20972456, 23145142
GO:0019789	Function	SUMO transferase activity	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	20408817
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0060395	Process	SMAD protein signal transduction	IDA	16777850
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IDA	11477070
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	20408817
GO:0061665	Function	SUMO ligase activity	IBA
GO:0061665	Function	SUMO ligase activity	IDA	18579533, 20408817

MIM	HGNC	e!Ensembl
603567	17311	ENSG00000078043

O75928

Protein name

E3 SUMO-protein ligase PIAS2 (EC 2.3.2.-) (Androgen receptor-interacting protein 3) (ARIP3) (DAB2-interacting protein) (DIP) (E3 SUMO-protein transferase PIAS2) (Msx-interacting zinc finger protein) (Miz1) (PIAS-NY protein) (Protein inhibitor of activated

Protein function

Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulator in various cellular pathways,

PDB

2ASQ , 4FO9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14324	PINIT	145 → 297	PINIT domain	Domain
PF02891	zf-MIZ	342 → 391	MIZ/SP-RING zinc finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Mainly expressed in testis. Isoform 3 is expressed predominantly in adult testis, weakly in pancreas, embryonic testis and sperm, and at very low levels in other organs. {ECO:0000269|PubMed:11439351, ECO:0000269|PubMed:15301740, ECO:00

Sequence

MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSS
RSETGVITSSGSNIPDIISLD

Sequence length

621

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis JAK-STAT signaling pathway		SUMOylation of DNA damage response and repair proteins SUMOylation of transcription factors SUMOylation of ubiquitinylation proteins SUMOylation of transcription cofactors SUMOylation of intracellular receptors SUMOylation of chromatin organization proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	35473503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	36748193	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Associate	29049012	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Associate	31103287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	19549844	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	24344134	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	21109931	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	34054823	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	27672034	★★★★★ ★☆☆☆☆ Found in Text Mining only
Radiation induced meningioma	Associate	21364586	★★★★★ ★☆☆☆☆ Found in Text Mining only

PIAS2 (protein inhibitor of activated STAT 2)