ARTN (artemin)

Gene

• Entrez ID: 9048
• Gene name: Artemin
• Gene symbol: ARTN
• Synonyms (NCBI Gene): ART, ENOVIN, EVN, NBN
• Chromosome: 1
• Chromosome location: 1p34.1
• Summary: This gene encodes a secreted ligand of the glial cell line-derived neurotrophic factor (GDNF) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006682	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	21453483
MIRT006682	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	21453483
MIRT756219	hsa-miR-940	Luciferase reporter assay, Western blotting, qRT-PCR, RNA pull down assay	36862282
MIRT801468	hsa-miR-105	CLIP-seq
MIRT801469	hsa-miR-205	CLIP-seq
MIRT801470	hsa-miR-3162-3p	CLIP-seq
MIRT801471	hsa-miR-3671	CLIP-seq
MIRT801472	hsa-miR-607	CLIP-seq
MIRT801473	hsa-miR-626	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9883723
GO:0005515	Function	Protein binding	IPI	16765900
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15204970
GO:0005615	Component	Extracellular space	IEA
GO:0007165	Process	Signal transduction	TAS	9883723
GO:0007399	Process	Nervous system development	IEA
GO:0007405	Process	Neuroblast proliferation	TAS	9883723
GO:0007411	Process	Axon guidance	IEA
GO:0007422	Process	Peripheral nervous system development	IBA
GO:0007422	Process	Peripheral nervous system development	IEA
GO:0007422	Process	Peripheral nervous system development	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	31535977
GO:0008083	Function	Growth factor activity	IEA
GO:0030116	Function	Glial cell-derived neurotrophic factor receptor binding	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0035860	Process	Glial cell-derived neurotrophic factor receptor signaling pathway	IDA	31535977
GO:0050930	Process	Induction of positive chemotaxis	IEA
GO:0061146	Process	Peyer's patch morphogenesis	IEA
GO:0097021	Process	Lymphocyte migration into lymphoid organs	IEA

Other IDs

• MIM: 603886
• HGNC: 727
• e!Ensembl: ENSG00000117407

Protein

• UniProt ID: Q5T4W7
• Protein name: Artemin (Enovin) (Neublastin)
• Protein function: Growth factor that supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain (PubMed:10583383, PubMed:9883723). Acts by binding to its corecepto
• PDB: 2ASK, 2GH0, 2GYR, 2GYZ, 6Q2S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00019	TGF_beta	122 → 218	Transforming growth factor beta like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Expressed at high levels in peripheral tissues including prostate, placenta, pancreas, heart, kidney, pituitary gland, lung and testis. Expressed at low levels in the brain. {ECO:0000269|PubMed:10583383, ECO:0000269|PubMed:
• Sequence:

  MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLAS
  PAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGA
  RGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGS
  RPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

• Sequence length: 220

Pathways

KEGG:

MAPK signaling pathway
PI3K-Akt signaling pathway

Reactome:

RAF/MAP kinase cascade
RET signaling