Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9048
Gene name Gene Name - the full gene name approved by the HGNC.	Artemin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ARTN
Synonyms (NCBI Gene) Gene synonyms aliases	ART, ENOVIN, EVN, NBN
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a secreted ligand of the glial cell line-derived neurotrophic factor (GDNF) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment a

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006682	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	21453483
MIRT006682	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	21453483
MIRT756219	hsa-miR-940	Luciferase reporter assay, Western blotting, qRT-PCR, RNA pull down assay	36862282
MIRT801468	hsa-miR-105	CLIP-seq
MIRT801469	hsa-miR-205	CLIP-seq
MIRT801470	hsa-miR-3162-3p	CLIP-seq
MIRT801471	hsa-miR-3671	CLIP-seq
MIRT801472	hsa-miR-607	CLIP-seq
MIRT801473	hsa-miR-626	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	9883723
GO:0005515	Function	Protein binding	IPI	16765900
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	15204970
GO:0005615	Component	Extracellular space	IEA
GO:0007165	Process	Signal transduction	TAS	9883723
GO:0007399	Process	Nervous system development	IEA
GO:0007405	Process	Neuroblast proliferation	TAS	9883723
GO:0007411	Process	Axon guidance	IEA
GO:0007422	Process	Peripheral nervous system development	IBA
GO:0007422	Process	Peripheral nervous system development	IEA
GO:0007422	Process	Peripheral nervous system development	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	31535977
GO:0008083	Function	Growth factor activity	IEA
GO:0030116	Function	Glial cell-derived neurotrophic factor receptor binding	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0035860	Process	Glial cell-derived neurotrophic factor receptor signaling pathway	IDA	31535977
GO:0050930	Process	Induction of positive chemotaxis	IEA
GO:0061146	Process	Peyer's patch morphogenesis	IEA
GO:0097021	Process	Lymphocyte migration into lymphoid organs	IEA

MIM	HGNC	e!Ensembl
603886	727	ENSG00000117407

Protein

UniProt ID

Q5T4W7

Protein name

Artemin (Enovin) (Neublastin)

Protein function

Growth factor that supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain (PubMed:10583383, PubMed:9883723). Acts by binding to its corecepto

PDB

2ASK , 2GH0 , 2GYR , 2GYZ , 6Q2S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00019	TGF_beta	122 → 218	Transforming growth factor beta like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Expressed at high levels in peripheral tissues including prostate, placenta, pancreas, heart, kidney, pituitary gland, lung and testis. Expressed at low levels in the brain. {ECO:0000269|PubMed:10583383, ECO:0000269|PubMed:

Sequence

MELGLGGLSTLSHCPWPRQQPALWPTLAALALLSSVAEASLGSAPRSPAPREGPPPVLAS
PAGHLPGGRTARWCSGRARRPPPQPSRPAPPPPAPPSALPRGGRAARAGGPGSRARAAGA
RGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGS
RPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG

Sequence length

220

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway PI3K-Akt signaling pathway		RAF/MAP kinase cascade RET signaling

ARTN (artemin)