DOK2 (docking protein 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9046
Gene name Gene Name - the full gene name approved by the HGNC.
Docking protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DOK2
Synonyms (NCBI Gene) Gene synonyms aliases
p56DOK, p56dok-2
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein wh
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(29)
miRTarBase ID miRNA Experiments Reference
MIRT041270 hsa-miR-193b-3p CLASH 23622248
MIRT498423 hsa-miR-365a-3p PAR-CLIP 22291592
MIRT498422 hsa-miR-365b-3p PAR-CLIP 22291592
MIRT498421 hsa-miR-155-5p PAR-CLIP 22291592
MIRT498420 hsa-miR-4715-3p PAR-CLIP 22291592
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0005068 Function Transmembrane receptor protein tyrosine kinase adaptor activity IEA
GO:0005515 Function Protein binding IPI 21044950, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604997 2991 ENSG00000147443
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O60496
Protein name Docking protein 2 (Downstream of tyrosine kinase 2) (p56(dok-2))
Protein function DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK2 may modulate the cellular proliferation induced by IL-4, as well as IL-2 and IL-3.
PDB 2D9W , 2DLW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02174 IRS 147 → 247 PTB domain (IRS-1 type) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in peripheral blood leukocytes, lymph nodes and spleen. Lower expression in thymus, bone marrow and fetal liver. {ECO:0000269|PubMed:9478921}.
Sequence 
MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVI
RLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKE
LSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALE
LWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEE
AISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYA
VPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSP
QEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
Sequence length 412
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Tie2 Signaling
RET signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dermatitis Atopic dermatitis N/A N/A GWAS
Diabetes Neuropathic pain in type 2 diabetes N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Show/Hide Text Mining Associations (11)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23874428
Breast Neoplasms Associate 26070530
Carcinoma Pancreatic Ductal Associate 30206226
Cardiovascular Diseases Associate 24243566
Colonic Neoplasms Associate 37884639
Leukemia Associate 16823827, 20697350
Neoplasm Metastasis Associate 23874428
Neoplasms Associate 24243566, 35127166
Osteosarcoma Associate 40668798
Ovarian Neoplasms Associate 23684582, 29229600