Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	90423
Gene name Gene Name - the full gene name approved by the HGNC.	ATPase H+ transporting V1 subunit E2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ATP6V1E2
Synonyms (NCBI Gene) Gene synonyms aliases	ATP6E1, ATP6EL2, ATP6V1EL2, VMA4
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p21\|2p16-p12

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052816	hsa-miR-3200-3p	CLASH	23622248
MIRT809386	hsa-miR-141	CLIP-seq
MIRT809387	hsa-miR-144	CLIP-seq
MIRT809388	hsa-miR-200a	CLIP-seq
MIRT809389	hsa-miR-3185	CLIP-seq
MIRT809390	hsa-miR-361-5p	CLIP-seq
MIRT809391	hsa-miR-3923	CLIP-seq
MIRT809392	hsa-miR-3973	CLIP-seq
MIRT809393	hsa-miR-4261	CLIP-seq
MIRT809394	hsa-miR-4496	CLIP-seq
MIRT809395	hsa-miR-4773	CLIP-seq
MIRT809396	hsa-miR-520g	CLIP-seq
MIRT809397	hsa-miR-520h	CLIP-seq
MIRT809398	hsa-miR-583	CLIP-seq
MIRT809399	hsa-miR-607	CLIP-seq
MIRT809391	hsa-miR-3923	CLIP-seq
MIRT809393	hsa-miR-4261	CLIP-seq
MIRT809394	hsa-miR-4496	CLIP-seq
MIRT809398	hsa-miR-583	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 25416956, 30021884, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0016241	Process	Regulation of macroautophagy	NAS	22982048
GO:0033178	Component	Proton-transporting two-sector ATPase complex, catalytic domain	IEA
GO:0046961	Function	Proton-transporting ATPase activity, rotational mechanism	IBA
GO:0046961	Function	Proton-transporting ATPase activity, rotational mechanism	IEA
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

MIM	HGNC	e!Ensembl
617385	18125	ENSG00000250565

Protein

UniProt ID

Q96A05

Protein name

V-type proton ATPase subunit E 2 (V-ATPase subunit E 2) (Vacuolar proton pump subunit E 2)

Protein function

Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01991	vATP-synt_E	18 → 216	ATP synthase (E/31 kDa) subunit	Family

Tissue specificity

TISSUE SPECIFICITY: Testis specific. {ECO:0000269|PubMed:12036578}.

Sequence

MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKK
EKQIEQQKKILMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLV
LQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGG
VEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKFFI

Sequence length

226

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Phagosome mTOR signaling pathway Synaptic vesicle cycle Collecting duct acid secretion Vibrio cholerae infection Epithelial cell signaling in Helicobacter pylori infection Human papillomavirus infection Rheumatoid arthritis		ROS and RNS production in phagocytes Insulin receptor recycling Transferrin endocytosis and recycling Amino acids regulate mTORC1 Ion channel transport

ATP6V1E2 (ATPase H+ transporting V1 subunit E2)