MACIR (macrophage immunometabolism regulator)

Gene

• Entrez ID: 90355
• Gene name: Macrophage immunometabolism regulator
• Gene symbol: MACIR
• Synonyms (NCBI Gene): C5orf30
• Chromosome: 5
• Chromosome location: 5q21.1
• Summary: This gene, MACIR (previously known as C5orf30), has been associated with rheumatoid arthritis, functioning as a negative regulator of tissue damage and modulating the activity of synovial fibroblasts and macrophages. The encoded protein is highly conserve

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22085962, 25416956, 28514442, 32296183, 32814053, 33961781, 36931259
GO:0005737	Component	Cytoplasm	IDA	22085962, 30659109
GO:0005737	Component	Cytoplasm	IEA
GO:0005929	Component	Cilium	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0010631	Process	Epithelial cell migration	IEA
GO:0010633	Process	Negative regulation of epithelial cell migration	IEA
GO:0010761	Process	Fibroblast migration	IEA
GO:0010764	Process	Negative regulation of fibroblast migration	IBA
GO:0010764	Process	Negative regulation of fibroblast migration	IEA
GO:0015031	Process	Protein transport	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0035869	Component	Ciliary transition zone	IDA	22085962
GO:0042995	Component	Cell projection	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IMP	30659109
GO:0060271	Process	Cilium assembly	ISS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IBA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA

Other IDs

• MIM: 616608
• HGNC: 25052
• e!Ensembl: ENSG00000181751

Protein

• UniProt ID: Q96GV9
• Protein name: Macrophage immunometabolism regulator
• Protein function: Regulates the macrophage function, by enhancing the resolution of inflammation and wound repair functions mediated by M2 macrophages (PubMed:30659109). The regulation of macrophage function is, due at least in part, to its ability to inhibit gly
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15435	UNC119_bdg	3 → 200	UNC119-binding protein C5orf30 homologue	Family

• Tissue specificity: TISSUE SPECIFICITY: High expression in normal macrophages, monocytes, and cultured rheumatoid arthritis synovial fibroblasts (RASFs), with lower expression in B- and T-cells, and little to no expression in other tissues and cell lines. {ECO:0000269|PubMed
• Sequence:

  MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNY
  LVGFTTGEELLKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIP
  AVNGRRRRRMPSSGDKCTKSLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEP
  ADTEVLQYQLQHLTLRGDRVFARNNT

• Sequence length: 206