UCN2 (urocortin 2)

Gene

• Entrez ID: 90226
• Gene name: Urocortin 2
• Gene symbol: UCN2
• Synonyms (NCBI Gene): SRP, UCN-II, UCNI, UR, URP
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1472710	hsa-miR-103a	CLIP-seq
MIRT1472711	hsa-miR-107	CLIP-seq
MIRT1472712	hsa-miR-31	CLIP-seq
MIRT1472713	hsa-miR-3183	CLIP-seq
MIRT1472714	hsa-miR-34a	CLIP-seq
MIRT1472715	hsa-miR-34c-5p	CLIP-seq
MIRT1472716	hsa-miR-3622b-5p	CLIP-seq
MIRT1472717	hsa-miR-3688-5p	CLIP-seq
MIRT1472718	hsa-miR-4330	CLIP-seq
MIRT1472719	hsa-miR-4432	CLIP-seq
MIRT1472720	hsa-miR-449a	CLIP-seq
MIRT1472721	hsa-miR-449b	CLIP-seq
MIRT1472722	hsa-miR-4645-3p	CLIP-seq
MIRT1472723	hsa-miR-4696	CLIP-seq
MIRT1472724	hsa-miR-4716-5p	CLIP-seq
MIRT1472725	hsa-miR-4723-3p	CLIP-seq
MIRT1472726	hsa-miR-483-3p	CLIP-seq
MIRT1472727	hsa-miR-885-3p	CLIP-seq
MIRT2142343	hsa-miR-4496	CLIP-seq
MIRT2362878	hsa-miR-190	CLIP-seq
MIRT2362879	hsa-miR-190b	CLIP-seq
MIRT1472718	hsa-miR-4330	CLIP-seq
MIRT2442822	hsa-miR-138	CLIP-seq
MIRT2442823	hsa-miR-4315	CLIP-seq
MIRT2442824	hsa-miR-4790-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	NAS	11329063
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11329063
GO:0007586	Process	Digestion	NAS	11329063
GO:0009755	Process	Hormone-mediated signaling pathway	IBA	21873635
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	11329063
GO:0031669	Process	Cellular response to nutrient levels	IBA	21873635
GO:0042562	Function	Hormone binding	IPI	11329063
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IBA	21873635
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IPI	11329063
GO:0051431	Function	Corticotropin-releasing hormone receptor 2 binding	IEA

Other IDs

• MIM: 605902
• HGNC: 18414
• e!Ensembl: ENSG00000145040

Protein

• UniProt ID: Q96RP3
• Protein name: Urocortin-2 (Stresscopin-related peptide) (Urocortin II) (Ucn II) (Urocortin-related peptide)
• Protein function: Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
• PDB: 2RMG, 3N95
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00473	CRF	72 → 109	Corticotropin-releasing factor family	Family

• Sequence:

  MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
  HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC

• Sequence length: 112

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Class B/2 (Secretin family receptors)

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Congestive heart failure	Congestive heart failure		16330704	ClinVar
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided		16330704	ClinVar
Myocardial infarction	Myocardial Failure		16330704	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Associate	34724890
Colorectal Neoplasms	Associate	28929494
Laryngeal Neoplasms	Inhibit	29499655
Neoplasms	Associate	29499655