UCN2 (urocortin 2)

Gene

• Entrez ID: 90226
• Gene name: Urocortin 2
• Gene symbol: UCN2
• Synonyms (NCBI Gene): SRP, UCN-II, UCNI, UR, URP
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1472710	hsa-miR-103a	CLIP-seq
MIRT1472711	hsa-miR-107	CLIP-seq
MIRT1472712	hsa-miR-31	CLIP-seq
MIRT1472713	hsa-miR-3183	CLIP-seq
MIRT1472714	hsa-miR-34a	CLIP-seq
MIRT1472715	hsa-miR-34c-5p	CLIP-seq
MIRT1472716	hsa-miR-3622b-5p	CLIP-seq
MIRT1472717	hsa-miR-3688-5p	CLIP-seq
MIRT1472718	hsa-miR-4330	CLIP-seq
MIRT1472719	hsa-miR-4432	CLIP-seq
MIRT1472720	hsa-miR-449a	CLIP-seq
MIRT1472721	hsa-miR-449b	CLIP-seq
MIRT1472722	hsa-miR-4645-3p	CLIP-seq
MIRT1472723	hsa-miR-4696	CLIP-seq
MIRT1472724	hsa-miR-4716-5p	CLIP-seq
MIRT1472725	hsa-miR-4723-3p	CLIP-seq
MIRT1472726	hsa-miR-483-3p	CLIP-seq
MIRT1472727	hsa-miR-885-3p	CLIP-seq
MIRT2142343	hsa-miR-4496	CLIP-seq
MIRT2362878	hsa-miR-190	CLIP-seq
MIRT2362879	hsa-miR-190b	CLIP-seq
MIRT1472718	hsa-miR-4330	CLIP-seq
MIRT2442822	hsa-miR-138	CLIP-seq
MIRT2442823	hsa-miR-4315	CLIP-seq
MIRT2442824	hsa-miR-4790-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	11329063
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11329063
GO:0007586	Process	Digestion	IEA
GO:0007586	Process	Digestion	NAS	11329063
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	11329063
GO:0031669	Process	Cellular response to nutrient levels	IBA
GO:0042562	Function	Hormone binding	IPI	11329063
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IBA
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IPI	11329063
GO:0051431	Function	Corticotropin-releasing hormone receptor 2 binding	IEA

Other IDs

• MIM: 605902
• HGNC: 18414
• e!Ensembl: ENSG00000145040

Protein

• UniProt ID: Q96RP3
• Protein name: Urocortin-2 (Stresscopin-related peptide) (Urocortin II) (Ucn II) (Urocortin-related peptide)
• Protein function: Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
• PDB: 2RMG, 3N95
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00473	CRF	72 → 109	Corticotropin-releasing factor family	Family

• Sequence:

  MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
  HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC

• Sequence length: 112

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Class B/2 (Secretin family receptors)