Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9021
Gene name Gene Name - the full gene name approved by the HGNC.
Suppressor of cytokine signaling 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SOCS3
Synonyms (NCBI Gene) Gene synonyms aliases
ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005062 hsa-miR-203a-3p Immunohistochemistry, In situ hybridization, Microarray, Western blot 17622355
MIRT005062 hsa-miR-203a-3p Luciferase reporter assay, qRT-PCR, Western blot 22207897
MIRT005062 hsa-miR-203a-3p Luciferase reporter assay, qRT-PCR, Western blot 22207897
MIRT007129 hsa-miR-30c-5p qRT-PCR 23418453
MIRT054389 hsa-let-7f-5p Luciferase reporter assay 22894925
Transcription factors
Transcription factor Regulation Reference
CEBPA Activation 19332118
NFKB1 Unknown 23335796
RELA Unknown 23335796
SP3 Unknown 10570957
STAT1 Unknown 19115200
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001784 Function Phosphotyrosine residue binding IEA
GO:0004860 Function Protein kinase inhibitor activity TAS 9266833
GO:0005126 Function Cytokine receptor binding IBA
GO:0005515 Function Protein binding IPI 19027008, 24728074, 25203322, 25416956, 32296183
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604176 19391 ENSG00000184557
Protein
UniProt ID O14543
Protein name Suppressor of cytokine signaling 3 (SOCS-3) (Cytokine-inducible SH2 protein 3) (CIS-3) (STAT-induced STAT inhibitor 3) (SSI-3)
Protein function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduc
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 46 127 SH2 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high expression in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney. Lower levels in thymus.
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHY
MPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Sequence length 225
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ubiquitin mediated proteolysis
Osteoclast differentiation
JAK-STAT signaling pathway
TNF signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease
Growth hormone synthesis, secretion and action
Hepatitis C
Influenza A
Herpes simplex virus 1 infection
  Interleukin-6 signaling
Interleukin-4 and Interleukin-13 signaling
Interferon gamma signaling
Regulation of IFNG signaling
PTK6 Activates STAT3
Neddylation
Interferon alpha/beta signaling
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Osteoarthritis Of Hip Osteoarthritis of the hip or knee (with total joint replacement) N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 32870172
Adenocarcinoma Associate 26482433, 35328735
Adenoma Islet Cell Associate 24633048
Adenomyosis Associate 32933042
Alzheimer Disease Associate 25286386, 26482433
Arthritis Inhibit 20690084
Arthritis Juvenile Associate 17530721, 37445800, 38001449
Arthritis Psoriatic Associate 21811995
Arthritis Rheumatoid Associate 15535835, 20690084, 30753680
Asthma Associate 23209423, 24037182, 25764157, 26464723, 31539147