Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	902
Gene name	Cyclin H
Gene symbol	CCNH
Synonyms (NCBI Gene)	CAKCycHp34p37
Chromosome	5
Chromosome location	5q14.3
Summary	The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT035962	hsa-miR-1301-3p	CLASH	23622248

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	23622515
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IEA
GO:0000439	Component	Transcription factor TFIIH core complex	IDA	8692841, 8692842
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0005515	Function	Protein binding	IPI	8521818, 9840943, 16189514, 16769902, 21516116, 21988832, 23393140, 25416956, 26496610, 27880917, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7936635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005675	Component	Transcription factor TFIIH holo complex	IDA	9852112
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	9852112
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IBA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	7533895, 8692841
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IDA	7533895
GO:0016301	Function	Kinase activity	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0050821	Process	Protein stabilization	IMP	23393140
GO:0070516	Component	CAK-ERCC2 complex	IDA	8692841, 8692842
GO:0070985	Component	Transcription factor TFIIK complex	IBA
GO:0070985	Component	Transcription factor TFIIK complex	IDA	8692841
GO:0070985	Component	Transcription factor TFIIK complex	IEA
GO:0070985	Component	Transcription factor TFIIK complex	IMP	23393140
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	23622515

MIM	HGNC	e!Ensembl
601953	1594	ENSG00000134480

P51946

Protein name

Cyclin-H (MO15-associated protein) (p34) (p37)

Protein function

Regulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription f

PDB

1JKW , 1KXU , 6O9L , 6XBZ , 6XD3 , 7B5O , 7B5Q , 7EGB , 7EGC , 7ENA , 7ENC , 7LBM , 7NVR , 8BVW , 8BYQ , 8GXQ , 8GXS , 8ORM , 8P6V , 8P6W , 8P6X , 8P6Y , 8P6Z , 8P70 , 8P71 , 8P72 , 8P73 , 8P74 , 8P75 , 8P76 , 8P77 , 8P78 , 8P79 , 8PLZ , 8PYR , 8S0R , 8S0T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	31 → 159	Cyclin, N-terminal domain	Domain
PF16899	Cyclin_C_2	162 → 260	Cyclin C-terminal domain	Domain

Sequence

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL

Sequence length

323

Interactions

View interactions

	KEGG		Reactome
	Basal transcription factors Nucleotide excision repair Cell cycle		Formation of RNA Pol II elongation complex Formation of the Early Elongation Complex Formation of Incision Complex in GG-NER RNA Polymerase II Pre-transcription Events Formation of TC-NER Pre-Incision Complex Transcription-Coupled Nucleotide Excision Repair (TC-NER) Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER TP53 Regulates Transcription of DNA Repair Genes Cyclin E associated events during G1/S transition Cyclin D associated events in G1 Cyclin A/B1/B2 associated events during G2/M transition Cyclin A:Cdk2-associated events at S phase entry mRNA Capping RNA Polymerase I Transcription Initiation RNA Polymerase I Promoter Escape RNA Polymerase II Promoter Escape RNA Polymerase II Transcription Pre-Initiation And Promoter Opening RNA Polymerase I Transcription Termination RNA Polymerase II Transcription Initiation RNA Polymerase II Transcription Elongation RNA Polymerase II Transcription Initiation And Promoter Clearance RNA Pol II CTD phosphorylation and interaction with CE RUNX1 regulates transcription of genes involved in differentiation of HSCs

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Colon adenocarcinoma	Uncertain significance	rs751218019	RCV005928873

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	30705370
Anemia	Associate	28924235
Breast Neoplasms	Associate	23393140, 30705370, 30947698
Breast Neoplasms	Stimulate	27301701
Carcinogenesis	Associate	16445666, 33777168
Carcinoma Endometrioid	Associate	16445666
Carcinoma Hepatocellular	Associate	30705370
Carcinoma Non Small Cell Lung	Associate	30705370
Colonic Neoplasms	Associate	15858123
Colorectal Neoplasms	Associate	30705370
Endometrial Hyperplasia	Associate	16445666
Esophageal Squamous Cell Carcinoma	Associate	25820824
Gastrointestinal Stromal Tumors	Associate	20598140
Glioblastoma	Associate	30705370
Hyperplasia	Associate	16445666
Lung Neoplasms	Stimulate	33777168
Lymphatic Metastasis	Stimulate	25820824
Mesothelioma Malignant	Stimulate	19218339
Microcephaly	Associate	30214071
Neoplasm Invasiveness	Associate	16445666
Neoplasm Metastasis	Associate	25820824
Neoplasms	Associate	11069302, 16445666, 23393140, 30705370, 33777168, 37240218, 9268294
Neoplasms	Stimulate	15858123, 20598140
Ovarian Neoplasms	Associate	30705370
Parkinson Disease	Associate	26961748
Peripheral Nervous System Diseases	Stimulate	24351404
Peripheral Nervous System Diseases	Associate	24351404
Prostatic Neoplasms	Associate	25238935, 34417538
Thyroid Neoplasms	Associate	35546566

CCNH (cyclin H)