Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9014
Gene name	TATA-box binding protein associated factor, RNA polymerase I subunit B
Gene symbol	TAF1B
Synonyms (NCBI Gene)	MGC:9349RAF1BRAFI63SL1TAFI63
Chromosome	2
Chromosome location	2p25.1
Summary	Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT632028	hsa-miR-154-5p	HITS-CLIP	23824327
MIRT632027	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632026	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT632025	hsa-miR-1281	HITS-CLIP	23824327
MIRT649567	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT632024	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT649566	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT632023	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT632022	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632021	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632020	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT632028	hsa-miR-154-5p	HITS-CLIP	23824327
MIRT632027	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632026	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT632025	hsa-miR-1281	HITS-CLIP	23824327
MIRT632024	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632023	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT632022	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632021	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632020	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT632019	hsa-miR-4695-5p	HITS-CLIP	23824327
MIRT632018	hsa-miR-4779	HITS-CLIP	23824327
MIRT632017	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT632016	hsa-miR-564	HITS-CLIP	23824327
MIRT632015	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632014	hsa-miR-4266	HITS-CLIP	23824327
MIRT632013	hsa-miR-651-5p	HITS-CLIP	23824327
MIRT443721	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT443720	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT443719	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT632028	hsa-miR-154-5p	HITS-CLIP	23824327
MIRT632027	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632026	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT632025	hsa-miR-1281	HITS-CLIP	23824327
MIRT649567	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT632024	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT649566	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT632023	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT632022	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632021	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632020	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT632028	hsa-miR-154-5p	HITS-CLIP	23824327
MIRT632027	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632026	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT632025	hsa-miR-1281	HITS-CLIP	23824327
MIRT632024	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632023	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT632022	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT632021	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT632020	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT632019	hsa-miR-4695-5p	HITS-CLIP	23824327
MIRT632018	hsa-miR-4779	HITS-CLIP	23824327
MIRT632017	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT632016	hsa-miR-564	HITS-CLIP	23824327
MIRT632015	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT632014	hsa-miR-4266	HITS-CLIP	23824327
MIRT632013	hsa-miR-651-5p	HITS-CLIP	23824327
MIRT443721	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT443720	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT443719	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT1409247	hsa-miR-496	CLIP-seq
MIRT2122712	hsa-miR-1	CLIP-seq
MIRT2122713	hsa-miR-1284	CLIP-seq
MIRT2122714	hsa-miR-1299	CLIP-seq
MIRT2122715	hsa-miR-206	CLIP-seq
MIRT2122716	hsa-miR-326	CLIP-seq
MIRT2122717	hsa-miR-330-5p	CLIP-seq
MIRT2122718	hsa-miR-3673	CLIP-seq
MIRT2122719	hsa-miR-3692	CLIP-seq
MIRT2122720	hsa-miR-4796-5p	CLIP-seq
MIRT2122721	hsa-miR-613	CLIP-seq
MIRT2122722	hsa-miR-759	CLIP-seq
MIRT2122723	hsa-miR-875-3p	CLIP-seq
MIRT2345098	hsa-miR-300	CLIP-seq
MIRT2345099	hsa-miR-381	CLIP-seq
MIRT2345100	hsa-miR-4789-5p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
UBTF	Unknown	10082553

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000120	Component	RNA polymerase I transcription regulator complex	IEA
GO:0001164	Function	RNA polymerase I core promoter sequence-specific DNA binding	IBA
GO:0001164	Function	RNA polymerase I core promoter sequence-specific DNA binding	IDA	21921198, 21921199
GO:0001164	Function	RNA polymerase I core promoter sequence-specific DNA binding	IEA
GO:0001188	Process	RNA polymerase I preinitiation complex assembly	IDA	21921199
GO:0001188	Process	RNA polymerase I preinitiation complex assembly	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	11250903, 17318177, 26496610, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	7801123
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005668	Component	RNA polymerase transcription factor SL1 complex	IBA
GO:0005668	Component	RNA polymerase transcription factor SL1 complex	IDA	11250903
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0006351	Process	DNA-templated transcription	NAS	7801123
GO:0006360	Process	Transcription by RNA polymerase I	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0017025	Function	TBP-class protein binding	TAS	21921199
GO:0042790	Process	Nucleolar large rRNA transcription by RNA polymerase I	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070860	Component	RNA polymerase I core factor complex	IBA
GO:0070860	Component	RNA polymerase I core factor complex	IDA	21921198, 21921199
GO:0070860	Component	RNA polymerase I core factor complex	IEA

MIM	HGNC	e!Ensembl
604904	11533	ENSG00000115750

Q53T94

Protein name

TATA box-binding protein-associated factor RNA polymerase I subunit B (RNA polymerase I-specific TBP-associated factor 63 kDa) (TAFI63) (TATA box-binding protein-associated factor 1B) (TBP-associated factor 1B) (Transcription initiation factor SL1/TIF-IB

Protein function

Component of RNA polymerase I core factor complex that acts as a GTF2B/TFIIB-like factor and plays a key role in multiple steps during transcription initiation such as pre-initiation complex (PIC) assembly and postpolymerase recruitment events i

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11781	zf-RRN7	7 → 39	Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7	Domain

Sequence

MDLEEAEEFKERCTQCAAVSWGLTDEGKYYCTSCHNVTERYQEVTNTDLIPNTQIKALNR
GLKKKNNTEKGWDWYVCEGFQYILYQQAEALKNLGVGPELKNDVLHNFWKRYLQKSKQAY
CKNPVYTTGRKPTVLEDNLSHSDWASEPELLSDVSCPPFLESGAESQSDIHTRKPFPVSK
ASQSETSVCSGSLDGVEYSQRKEKGIVKMTMPQTLAFCYLSLLWQREAITLSDLLRFVEE
DHIPYINAFQHFPEQMKLYGRDRGIFGIESWPDYEDIYKKTVEVGTFLDLPRFPDITEDC
YLHPNILCMKYLMEVNLPDEMHSLTCHVVKMTGMGEVDFLTFDPIAKMAKTVKYDVQAVA
IIVVVLKLLFLLDDSFEWSLSNLAEKHNEKNKKDKPWFDFRKWYQIMKKAFDEKKQKWEE
ARAKYLWKSEKPLYYSFVDKPVAYKKREMVVNLQKQFSTLVESTATAGKKSPSSFQFNWT
EEDTDRTCFHGHSLQGVLKEKGQSLLTKNSLYWLSTQKFCRCYCTHVTTYEESNYSLSYQ
FILNLFSFLLRIKTSLLHEEVSLVEKKLFEKKYSVKRKKSRSKKVRRH

Sequence length

588

Interactions

View interactions

	Reactome
			B-WICH complex positively regulates rRNA expression RNA Polymerase I Transcription Initiation RNA Polymerase I Promoter Escape RNA Polymerase I Transcription Termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYNCH SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MISMATCH REPAIR CANCER SYNDROME 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial cleft 1	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Anodontia	Associate	19957108	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	19503063, 19957108, 29703930	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19503063	★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Associate	28232668	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Papilloma Choroid Plexus	Associate	29703930	★★★★★ ★☆☆☆☆ Found in Text Mining only

TAF1B (TATA-box binding protein associated factor, RNA polymerase I subunit B)