Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
90121
Gene name Gene Name - the full gene name approved by the HGNC.
TSR2 ribosome maturation factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSR2
Synonyms (NCBI Gene) Gene synonyms aliases
DBA14, DT1P1A10, WGG1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
DBA14
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.22
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene appears to repress the transcription of NF-kappaB and may be involved in apoptosis. Defects in this gene are a cause of Diamond-Blackfan anemia. [provided by RefSeq, Oct 2016]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs786203996 A>G Pathogenic Missense variant, 5 prime UTR variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022680 hsa-miR-124-3p Microarray 18668037
MIRT036048 hsa-miR-1301-3p CLASH 23622248
MIRT1460536 hsa-miR-1207-5p CLIP-seq
MIRT1460537 hsa-miR-147 CLIP-seq
MIRT1460538 hsa-miR-1909 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000462 Process Maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IBA 21873635
GO:0005515 Function Protein binding IPI 16189514, 19060904, 20562859, 25416956, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300945 25455 ENSG00000158526
Protein
UniProt ID Q969E8
Protein name Pre-rRNA-processing protein TSR2 homolog
Protein function May be involved in 20S pre-rRNA processing.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10273 WGG 12 91 Pre-rRNA-processing protein TSR2 Family
Sequence
MAGAAEDARALFRAGVCAALEAWPALQIAVENGFGGVHSQEKAKWLGGAVEDYFMRNADL
ELDEVEDFLGELLTNEFDTVVEDGSLPQVSQ
QLQTMFHHFQRGDGAALREMASCITQRKC
KVTATALKTARETDEDEDDVDSVEEMEVTATNDGAATDGVCPQPEPSDPDAQTIKEEDIV
EDGWTIVRRKK
Sequence length 191
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Aarskog syndrome Aarskog syndrome rs28935497, rs137853266, rs1569541255, rs137853267, rs387906718, rs756586058, rs1557189608, rs1557189252, rs1269514277, rs1557191567, rs1601953552, rs1601954686, rs1601950553, rs1601953661, rs1922859149
Anemia Anemia, Macrocytic, Anemia, Diamond-Blackfan rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
24942156, 28297620
Diamond-blackfan anemia with mandibulofacial dysostosis DIAMOND-BLACKFAN ANEMIA 14 WITH MANDIBULOFACIAL DYSOSTOSIS rs786203996, rs786203997, rs148942765, rs786203998 24942156
Hearing loss Conductive hearing loss rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Unknown
Disease term Disease name Evidence References Source
Diamond-Blackfan Anemia With Mandibulofacial Dysostosis Diamond-Blackfan anemia 14 with mandibulofacial dysostosis GenCC
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Anemia Diamond Blackfan Associate 24942156, 30201955
Lupus Erythematosus Systemic Associate 35864995
Mandibulofacial Dysostosis Associate 24942156