Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	90025
Gene name Gene Name - the full gene name approved by the HGNC.	Ubiquitin protein ligase E3D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UBE3D
Synonyms (NCBI Gene) Gene synonyms aliases	C6orf157, H10BH, UBE2CBP, YJR141W
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q14.1

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IBA
GO:0000151	Component	Ubiquitin ligase complex	IDA	15749827
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0000209	Process	Protein polyubiquitination	IDA	15749827
GO:0005515	Function	Protein binding	IPI	27173435, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	39032490
GO:0006513	Process	Protein monoubiquitination	IBA
GO:0006513	Process	Protein monoubiquitination	IDA	15749827
GO:0008428	Function	Ribonuclease inhibitor activity	IDA	39032490
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030332	Function	Cyclin binding	IBA
GO:0030332	Function	Cyclin binding	IPI	15749827
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0044390	Function	Ubiquitin-like protein conjugating enzyme binding	IPI	15749827
GO:0051865	Process	Protein autoubiquitination	IBA
GO:0051865	Process	Protein autoubiquitination	IDA	15749827
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	15749827
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
612495	21381	ENSG00000118420

Protein

UniProt ID

Q7Z6J8

Protein name

E3 ubiquitin-protein ligase E3D (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase E3D) (UbcH10-binding protein with a HECT-like domain) (Ubiquitin-conjugating enzyme E2C-binding protein)

Protein function

E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome (PubMed:15749827). Independently of its E3 ubiquitin-prot

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09814	HECT_2	13 → 384	HECT-like Ubiquitin-conjugating enzyme (E2)-binding	Domain

Sequence

MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPMNISIMPSSLQMKTPEGCTEIQLPAE
VRLVPSSCRGLQFVVGDGLHLRLQTQAKLGTKLISMFNQSSQTQECCTFYCQSCGEVIIK
DRKLLRVLPLPSENWGALVGEWCCHPDPFANKSLHPQENDCFIGDSFFLVNLRTSLWQQR
PELSPVEMCCVSSDNHCKLEPKANTKVICKRCKVMLGETVSSETTKFYMTEIIIQSSERS
FPIIPRSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVYILLWLLNSDSLVIESLRNSK
YIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLE
LLLILSKSNANLPSSLRRVNSFQVAFLKM

Sequence length

389

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

UBE3D (ubiquitin protein ligase E3D)