Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	90025
Gene name Gene Name - the full gene name approved by the HGNC.	Ubiquitin protein ligase E3D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UBE3D
Synonyms (NCBI Gene) Gene synonyms aliases	C6orf157, H10BH, UBE2CBP, YJR141W
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q14.1

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IBA	21873635
GO:0000151	Component	Ubiquitin ligase complex	IDA	15749827
GO:0000209	Process	Protein polyubiquitination	IBA	21873635
GO:0000209	Process	Protein polyubiquitination	IDA	15749827
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005829	Component	Cytosol	IBA	21873635
GO:0006513	Process	Protein monoubiquitination	IBA	21873635
GO:0006513	Process	Protein monoubiquitination	IDA	15749827
GO:0030332	Function	Cyclin binding	IBA	21873635
GO:0030332	Function	Cyclin binding	IPI	15749827
GO:0031624	Function	Ubiquitin conjugating enzyme binding	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0044390	Function	Ubiquitin-like protein conjugating enzyme binding	IPI	15749827
GO:0051865	Process	Protein autoubiquitination	IBA	21873635
GO:0051865	Process	Protein autoubiquitination	IDA	15749827
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	15749827

MIM	HGNC	e!Ensembl
612495	21381	ENSG00000118420

Protein

UniProt ID

Q7Z6J8

Protein name

E3 ubiquitin-protein ligase E3D (EC 2.3.2.26) (HECT-type E3 ubiquitin transferase E3D) (UbcH10-binding protein with a HECT-like domain) (Ubiquitin-conjugating enzyme E2C-binding protein)

Protein function

E3 ubiquitin-protein ligase which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfers it to substrates, generally promoting their degradation by the proteasome (PubMed:15749827). Independently of its E3 ubiquitin-prot

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09814	HECT_2	13 → 384	HECT-like Ubiquitin-conjugating enzyme (E2)-binding	Domain

Sequence

MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPMNISIMPSSLQMKTPEGCTEIQLPAE
VRLVPSSCRGLQFVVGDGLHLRLQTQAKLGTKLISMFNQSSQTQECCTFYCQSCGEVIIK
DRKLLRVLPLPSENWGALVGEWCCHPDPFANKSLHPQENDCFIGDSFFLVNLRTSLWQQR
PELSPVEMCCVSSDNHCKLEPKANTKVICKRCKVMLGETVSSETTKFYMTEIIIQSSERS
FPIIPRSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVYILLWLLNSDSLVIESLRNSK
YIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLE
LLLILSKSNANLPSSLRRVNSFQVAFLKM

Sequence length

389

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Crohn disease	Crohn Disease	26891255	ClinVar
Crohn Disease	Crohn Disease		GWAS
Metabolic Syndrome	Metabolic Syndrome		GWAS
Diabetes	Diabetes		GWAS

UBE3D (ubiquitin protein ligase E3D)