Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
900
Gene name Gene Name - the full gene name approved by the HGNC.
Cyclin G1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCNG1
Synonyms (NCBI Gene) Gene synonyms aliases
CCNG
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q34
Summary Summary of gene provided in NCBI Entrez Gene.
The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded prote
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003006 hsa-miR-122-5p Reporter assay 17616664
MIRT003006 hsa-miR-122-5p Western blot 19584283
MIRT006782 hsa-miR-9-5p Luciferase reporter assay, Microarray, qRT-PCR, Western blot 22761433
MIRT003006 hsa-miR-122-5p qRT-PCR 23126531
MIRT006782 hsa-miR-9-5p Microarray 17612493
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity IBA 21873635
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IBA 21873635
GO:0005515 Function Protein binding IPI 17245430, 21516116, 21988832, 25416956, 28330616, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IBA 21873635
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601578 1592 ENSG00000113328
Protein
UniProt ID P51959
Protein name Cyclin-G1 (Cyclin-G)
Protein function May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 16 150 Cyclin, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: High levels in skeletal muscle, ovary, kidney and colon.
Sequence
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVK
ATTAFQFLQLYYSLLQENLPLERRNSINFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
Sequence length 295
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  p53 signaling pathway
MicroRNAs in cancer
  Regulation of TP53 Degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 16289808
Unknown
Disease term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acute Radiation Syndrome Associate 38499035
Breast Neoplasms Associate 10196184, 22342720, 26804550, 29513878
Carcinoma Hepatocellular Associate 21730188, 34623217
Cerebral Infarction Associate 37119591
Colorectal Neoplasms Associate 22241525
Esophageal Squamous Cell Carcinoma Associate 39511268
HIV Infections Associate 27064238, 28132517
Leukemia Lymphocytic Chronic B Cell Associate 18945750
Neoplasm Metastasis Associate 32271408
Neoplasms Associate 10196184, 20150764, 21730188, 22056875, 29787434, 30565428