Gene Gene information from NCBI Gene database.
Entrez ID 900
Gene name Cyclin G1
Gene symbol CCNG1
Synonyms (NCBI Gene)
CCNG
Chromosome 5
Chromosome location 5q34
Summary The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded prote
miRNA miRNA information provided by mirtarbase database.
884
miRTarBase ID miRNA Experiments Reference
MIRT003006 hsa-miR-122-5p Reporter assay 17616664
MIRT003006 hsa-miR-122-5p Western blot 19584283
MIRT006782 hsa-miR-9-5p Luciferase reporter assayMicroarrayqRT-PCRWestern blot 22761433
MIRT003006 hsa-miR-122-5p qRT-PCR 23126531
MIRT006782 hsa-miR-9-5p Microarray 17612493
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0000079 Process Regulation of cyclin-dependent protein serine/threonine kinase activity TAS 8626390
GO:0000082 Process G1/S transition of mitotic cell cycle IBA
GO:0000307 Component Cyclin-dependent protein kinase holoenzyme complex IBA
GO:0005515 Function Protein binding IPI 17245430, 21516116, 21988832, 25416956, 28330616, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601578 1592 ENSG00000113328
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P51959
Protein name Cyclin-G1 (Cyclin-G)
Protein function May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00134 Cyclin_N 16 150 Cyclin, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: High levels in skeletal muscle, ovary, kidney and colon.
Sequence
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVK
ATTAFQFLQLYYSLLQENLPLERRNSINFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
Sequence length 295
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  p53 signaling pathway
MicroRNAs in cancer
  Regulation of TP53 Degradation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hereditary breast ovarian cancer syndrome Uncertain significance rs747511557 RCV001374478
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Radiation Syndrome Associate 38499035
Breast Neoplasms Associate 10196184, 22342720, 26804550, 29513878
Carcinoma Hepatocellular Associate 21730188, 34623217
Cerebral Infarction Associate 37119591
Colorectal Neoplasms Associate 22241525
Esophageal Squamous Cell Carcinoma Associate 39511268
HIV Infections Associate 27064238, 28132517
Leukemia Lymphocytic Chronic B Cell Associate 18945750
Neoplasm Metastasis Associate 32271408
Neoplasms Associate 10196184, 20150764, 21730188, 22056875, 29787434, 30565428