Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	89941
Gene name	Ras homolog family member T2
Gene symbol	RHOT2
Synonyms (NCBI Gene)	ARHT2C16orf39MIRO-2MIRO2RASL
Chromosome	16
Chromosome location	16p13.3
Summary	This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. [provided by RefSeq, Nov 2011]

Show/Hide all (70)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030517	hsa-miR-24-3p	Microarray	19748357
MIRT049436	hsa-miR-92a-3p	CLASH	23622248
MIRT036780	hsa-miR-760	CLASH	23622248
MIRT1306065	hsa-miR-1228	CLIP-seq
MIRT1306066	hsa-miR-188-3p	CLIP-seq
MIRT1306067	hsa-miR-1914	CLIP-seq
MIRT1306068	hsa-miR-1976	CLIP-seq
MIRT1306069	hsa-miR-3144-5p	CLIP-seq
MIRT1306070	hsa-miR-3157-5p	CLIP-seq
MIRT1306071	hsa-miR-3184	CLIP-seq
MIRT1306072	hsa-miR-337-5p	CLIP-seq
MIRT1306073	hsa-miR-3689a-3p	CLIP-seq
MIRT1306074	hsa-miR-3689c	CLIP-seq
MIRT1306075	hsa-miR-370	CLIP-seq
MIRT1306076	hsa-miR-423-5p	CLIP-seq
MIRT1306077	hsa-miR-4300	CLIP-seq
MIRT1306078	hsa-miR-4691-3p	CLIP-seq
MIRT1306079	hsa-miR-4707-5p	CLIP-seq
MIRT1306080	hsa-miR-532-3p	CLIP-seq
MIRT1306081	hsa-miR-767-3p	CLIP-seq
MIRT1306082	hsa-miR-920	CLIP-seq
MIRT1306068	hsa-miR-1976	CLIP-seq
MIRT1306070	hsa-miR-3157-5p	CLIP-seq
MIRT1306073	hsa-miR-3689a-3p	CLIP-seq
MIRT1306074	hsa-miR-3689c	CLIP-seq
MIRT1306075	hsa-miR-370	CLIP-seq
MIRT1306077	hsa-miR-4300	CLIP-seq
MIRT1306078	hsa-miR-4691-3p	CLIP-seq
MIRT1306081	hsa-miR-767-3p	CLIP-seq
MIRT1306082	hsa-miR-920	CLIP-seq
MIRT2315363	hsa-miR-1322	CLIP-seq
MIRT1306067	hsa-miR-1914	CLIP-seq
MIRT2315364	hsa-miR-1915	CLIP-seq
MIRT1306068	hsa-miR-1976	CLIP-seq
MIRT1306070	hsa-miR-3157-5p	CLIP-seq
MIRT1306073	hsa-miR-3689a-3p	CLIP-seq
MIRT1306074	hsa-miR-3689c	CLIP-seq
MIRT1306075	hsa-miR-370	CLIP-seq
MIRT1306077	hsa-miR-4300	CLIP-seq
MIRT2315365	hsa-miR-4643	CLIP-seq
MIRT2315366	hsa-miR-4651	CLIP-seq
MIRT1306078	hsa-miR-4691-3p	CLIP-seq
MIRT1306079	hsa-miR-4707-5p	CLIP-seq
MIRT2315367	hsa-miR-4758-3p	CLIP-seq
MIRT2315368	hsa-miR-541	CLIP-seq
MIRT2315369	hsa-miR-608	CLIP-seq
MIRT2315370	hsa-miR-654-5p	CLIP-seq
MIRT1306081	hsa-miR-767-3p	CLIP-seq
MIRT1306082	hsa-miR-920	CLIP-seq
MIRT1306068	hsa-miR-1976	CLIP-seq
MIRT1306070	hsa-miR-3157-5p	CLIP-seq
MIRT1306073	hsa-miR-3689a-3p	CLIP-seq
MIRT1306074	hsa-miR-3689c	CLIP-seq
MIRT1306075	hsa-miR-370	CLIP-seq
MIRT1306077	hsa-miR-4300	CLIP-seq
MIRT1306078	hsa-miR-4691-3p	CLIP-seq
MIRT1306081	hsa-miR-767-3p	CLIP-seq
MIRT1306082	hsa-miR-920	CLIP-seq
MIRT2611684	hsa-miR-3136-3p	CLIP-seq
MIRT2611685	hsa-miR-3140-3p	CLIP-seq
MIRT1306069	hsa-miR-3144-5p	CLIP-seq
MIRT1306071	hsa-miR-3184	CLIP-seq
MIRT2611686	hsa-miR-328	CLIP-seq
MIRT1306072	hsa-miR-337-5p	CLIP-seq
MIRT1306076	hsa-miR-423-5p	CLIP-seq
MIRT2611687	hsa-miR-4290	CLIP-seq
MIRT2611688	hsa-miR-4297	CLIP-seq
MIRT2611689	hsa-miR-4667-3p	CLIP-seq
MIRT2611690	hsa-miR-4687-5p	CLIP-seq
MIRT2611691	hsa-miR-614	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	27605430
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16630562, 19528298, 24995978, 32296183, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	12482879, 19528298
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0007005	Process	Mitochondrion organization	IBA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IDA	30513825
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0019003	Function	GDP binding	IDA	27605430
GO:0019725	Process	Cellular homeostasis	IMP	12482879
GO:0046872	Function	Metal ion binding	IEA
GO:0047497	Process	Mitochondrion transport along microtubule	IBA
GO:0047497	Process	Mitochondrion transport along microtubule	IEA
GO:0047497	Process	Mitochondrion transport along microtubule	IMP	16630562
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IEA
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IMP	12482879

MIM	HGNC	e!Ensembl
613889	21169	ENSG00000140983

Q8IXI1

Protein name

Mitochondrial Rho GTPase 2 (MIRO-2) (hMiro-2) (EC 3.6.5.-) (Ras homolog gene family member T2)

Protein function

Atypical mitochondrial nucleoside-triphosphatase (NTPase) involved in mitochondrial trafficking (PubMed:16630562, PubMed:22396657, PubMed:30513825). Probably involved in control of anterograde transport of mitochondria and their subcellular dist

PDB

5KUT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	6 → 168	Ras family	Domain
PF08356	EF_assoc_2	219 → 305	EF hand associated	Family
PF08355	EF_assoc_1	341 → 411	EF hand associated	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Highly expressed in heart, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:12482879, ECO:0000269|PubMed:15218247}.

Sequence

MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSE
AEQTDEELREEIHKANVVCVVYDVSEEATIEKIRTKWIPLVNGGTTQGPRVPIILVGNKS
DLRSGSSMEAVLPIMSQFPEIETCVECSAKNLRNISELFYYAQKAVLHPTAPLYDPEAKQ
LRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGG
VREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTE
LNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHG
YLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCK
VVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLAT
SLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPA
EFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGA
AVAAVLSFSLYRVLVKSQ

Sequence length

618

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal		Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Colorectal Neoplasms	Associate	37158593	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	40273911	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	40273911	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	37158593	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	27991488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	32948353, 34148545	★★★★★ ★☆☆☆☆ Found in Text Mining only

RHOT2 (ras homolog family member T2)