PGLYRP1 (peptidoglycan recognition protein 1)

Gene

• Entrez ID: 8993
• Gene name: Peptidoglycan recognition protein 1
• Gene symbol: PGLYRP1
• Synonyms (NCBI Gene): PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L
• Chromosome: 19
• Chromosome location: 19q13.32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018270	hsa-miR-335-5p	Microarray	18185580
MIRT051104	hsa-miR-16-5p	CLASH	23622248
MIRT1227520	hsa-miR-342-5p	CLIP-seq
MIRT1227521	hsa-miR-3689a-3p	CLIP-seq
MIRT1227522	hsa-miR-3689c	CLIP-seq
MIRT1227523	hsa-miR-4466	CLIP-seq
MIRT1227524	hsa-miR-4651	CLIP-seq
MIRT1227525	hsa-miR-4664-5p	CLIP-seq
MIRT1227526	hsa-miR-4728-5p	CLIP-seq
MIRT1227527	hsa-miR-608	CLIP-seq
MIRT1227528	hsa-miR-675	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	11461926
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	14585845, 25595774, 26654597
GO:0006955	Process	Immune response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008745	Function	N-acetylmuramoyl-L-alanine amidase activity	IEA
GO:0009253	Process	Peptidoglycan catabolic process	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0016019	Function	Peptidoglycan immune receptor activity	IBA
GO:0016019	Function	Peptidoglycan immune receptor activity	IDA	11461926
GO:0016019	Function	Peptidoglycan immune receptor activity	IEA
GO:0016045	Process	Detection of bacterium	IDA	11461926
GO:0016045	Process	Detection of bacterium	IEA
GO:0030544	Function	Hsp70 protein binding	IDA	14585845
GO:0031640	Process	Killing of cells of another organism	IDA	16354652
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032827	Process	Negative regulation of natural killer cell differentiation involved in immune response	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042834	Function	Peptidoglycan binding	IBA
GO:0042834	Function	Peptidoglycan binding	IDA	11461926, 16354652, 17502600
GO:0042834	Function	Peptidoglycan binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	11461926
GO:0048018	Function	Receptor ligand activity	IDA	25595774
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	11461926, 16354652
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051701	Process	Biological process involved in interaction with host	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	26654597
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	16354652
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0097013	Component	Phagocytic vesicle lumen	TAS
GO:1904724	Component	Tertiary granule lumen	TAS

Other IDs

• MIM: 604963
• HGNC: 8904
• e!Ensembl: ENSG00000008438

Protein

• UniProt ID: O75594
• Protein name: Peptidoglycan recognition protein 1 (Peptidoglycan recognition protein short) (PGRP-S)
• Protein function: Innate immunity protein that plays several important functions in antimicrobial and antitumor defense systems. Acts as a pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria and thus provides bactericidal activity
• PDB: 1YCK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01510	Amidase_2	51 → 181	N-acetylmuramoyl-L-alanine amidase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in bone marrow. Weak expression found in kidney, liver, small intestine, spleen, thymus, peripheral leukocyte, lung, fetal spleen and neutrophils. {ECO:0000269|PubMed:11461926, ECO:0000269|PubMed:9707603}.
• Sequence:

  MSRRSMLLAWALPSLLRLGAAQETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVS
  HTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGH
  LWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPG
  NQLYHLIQNWPHYRSP

• Sequence length: 196

Pathways

Reactome:

Neutrophil degranulation
Antimicrobial peptides

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	38213773	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Associate	34480465	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	33565964	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	34722779	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	15598955, 32240562	★☆☆☆☆ Found in Text Mining only
Cardiotoxicity	Stimulate	39273682	★☆☆☆☆ Found in Text Mining only
Chlamydial Pneumonia	Inhibit	33280575	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	34183667	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Inhibit	37939716	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Stimulate	34183667	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	37522815	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Stimulate	15598955	★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	29774543	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	35329310	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	15598955, 32240562	★☆☆☆☆ Found in Text Mining only
Mucositis	Associate	35329310	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	15598955, 17551095, 32240562	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	16838325	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	32925767	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	24838182	★☆☆☆☆ Found in Text Mining only
ST Elevation Myocardial Infarction	Associate	26025919	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Associate	34542421	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Associate	31801935	★☆☆☆☆ Found in Text Mining only
Thrombosis	Inhibit	35955827	★☆☆☆☆ Found in Text Mining only
Tuberculosis Pulmonary	Stimulate	37522815	★☆☆☆☆ Found in Text Mining only
Winter Shortland Temple syndrome	Associate	34722779	★☆☆☆☆ Found in Text Mining only