Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8991
Gene name Gene Name - the full gene name approved by the HGNC.	Selenium binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SELENBP1
Synonyms (NCBI Gene) Gene synonyms aliases	EHMTO, HEL-S-134P, LPSB, MTO, SBP56, SP56, hSBP
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. The effects of selenium in preventing

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs758495626	C>A,T	Pathogenic, likely-pathogenic	Intron variant, coding sequence variant, missense variant
rs1357490520	C>A,T	Pathogenic	Splice donor variant
rs1553204817	C>A	Likely-pathogenic, pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs1553204840	G>A	Likely-pathogenic, pathogenic	Non coding transcript variant, coding sequence variant, missense variant

Show/Hide all(79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017378	hsa-miR-335-5p	Microarray	18185580
MIRT029152	hsa-miR-26b-5p	Microarray	19088304
MIRT050594	hsa-miR-20a-5p	CLASH	23622248
MIRT049678	hsa-miR-92a-3p	CLASH	23622248
MIRT1334251	hsa-miR-128	CLIP-seq
MIRT1334252	hsa-miR-15a	CLIP-seq
MIRT1334253	hsa-miR-15b	CLIP-seq
MIRT1334254	hsa-miR-16	CLIP-seq
MIRT1334255	hsa-miR-195	CLIP-seq
MIRT1334256	hsa-miR-3064-3p	CLIP-seq
MIRT1334257	hsa-miR-3148	CLIP-seq
MIRT1334258	hsa-miR-335	CLIP-seq
MIRT1334259	hsa-miR-3545-5p	CLIP-seq
MIRT1334260	hsa-miR-3670	CLIP-seq
MIRT1334261	hsa-miR-3688-3p	CLIP-seq
MIRT1334262	hsa-miR-424	CLIP-seq
MIRT1334263	hsa-miR-4317	CLIP-seq
MIRT1334264	hsa-miR-4709-5p	CLIP-seq
MIRT1334265	hsa-miR-4715-3p	CLIP-seq
MIRT1334266	hsa-miR-490-5p	CLIP-seq
MIRT1334267	hsa-miR-497	CLIP-seq
MIRT1334268	hsa-miR-578	CLIP-seq
MIRT1334251	hsa-miR-128	CLIP-seq
MIRT1334252	hsa-miR-15a	CLIP-seq
MIRT1334253	hsa-miR-15b	CLIP-seq
MIRT1334254	hsa-miR-16	CLIP-seq
MIRT1334255	hsa-miR-195	CLIP-seq
MIRT1334257	hsa-miR-3148	CLIP-seq
MIRT1334259	hsa-miR-3545-5p	CLIP-seq
MIRT1334260	hsa-miR-3670	CLIP-seq
MIRT1334261	hsa-miR-3688-3p	CLIP-seq
MIRT1334262	hsa-miR-424	CLIP-seq
MIRT1334264	hsa-miR-4709-5p	CLIP-seq
MIRT1334266	hsa-miR-490-5p	CLIP-seq
MIRT1334267	hsa-miR-497	CLIP-seq
MIRT1334251	hsa-miR-128	CLIP-seq
MIRT2323722	hsa-miR-147	CLIP-seq
MIRT1334252	hsa-miR-15a	CLIP-seq
MIRT1334253	hsa-miR-15b	CLIP-seq
MIRT1334254	hsa-miR-16	CLIP-seq
MIRT1334255	hsa-miR-195	CLIP-seq
MIRT2323723	hsa-miR-2278	CLIP-seq
MIRT1334257	hsa-miR-3148	CLIP-seq
MIRT1334258	hsa-miR-335	CLIP-seq
MIRT2323724	hsa-miR-3616-3p	CLIP-seq
MIRT1334260	hsa-miR-3670	CLIP-seq
MIRT1334261	hsa-miR-3688-3p	CLIP-seq
MIRT2323725	hsa-miR-3911	CLIP-seq
MIRT1334262	hsa-miR-424	CLIP-seq
MIRT2323726	hsa-miR-4453	CLIP-seq
MIRT2323727	hsa-miR-4468	CLIP-seq
MIRT2323728	hsa-miR-4480	CLIP-seq
MIRT2323729	hsa-miR-4536	CLIP-seq
MIRT2323730	hsa-miR-4538	CLIP-seq
MIRT2323731	hsa-miR-4687-3p	CLIP-seq
MIRT2323732	hsa-miR-4721	CLIP-seq
MIRT2323733	hsa-miR-4786-3p	CLIP-seq
MIRT1334267	hsa-miR-497	CLIP-seq
MIRT2323734	hsa-miR-644	CLIP-seq
MIRT2323735	hsa-miR-647	CLIP-seq
MIRT2323722	hsa-miR-147	CLIP-seq
MIRT1334256	hsa-miR-3064-3p	CLIP-seq
MIRT2323725	hsa-miR-3911	CLIP-seq
MIRT2323726	hsa-miR-4453	CLIP-seq
MIRT2323729	hsa-miR-4536	CLIP-seq
MIRT2323730	hsa-miR-4538	CLIP-seq
MIRT2323731	hsa-miR-4687-3p	CLIP-seq
MIRT2323734	hsa-miR-644	CLIP-seq
MIRT2323735	hsa-miR-647	CLIP-seq
MIRT2323722	hsa-miR-147	CLIP-seq
MIRT1334256	hsa-miR-3064-3p	CLIP-seq
MIRT2323725	hsa-miR-3911	CLIP-seq
MIRT2323726	hsa-miR-4453	CLIP-seq
MIRT2323728	hsa-miR-4480	CLIP-seq
MIRT2323729	hsa-miR-4536	CLIP-seq
MIRT2323730	hsa-miR-4538	CLIP-seq
MIRT2323731	hsa-miR-4687-3p	CLIP-seq
MIRT2323734	hsa-miR-644	CLIP-seq
MIRT2323735	hsa-miR-647	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	16189514, 19118533, 29892012, 31515488, 32296183
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0008430	Function	Selenium binding	IEA
GO:0008430	Function	Selenium binding	TAS	9027582
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0018549	Function	Methanethiol oxidase activity	IEA
GO:0018549	Function	Methanethiol oxidase activity	IMP	29255262
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
604188	10719	ENSG00000143416

Protein

UniProt ID

Q13228

Protein name

Methanethiol oxidase (MTO) (EC 1.8.3.4) (56 kDa selenium-binding protein) (SBP56) (SP56) (Selenium-binding protein 1)

Protein function

Catalyzes the oxidation of methanethiol, an organosulfur compound known to be produced in substantial amounts by gut bacteria (PubMed:29255262). Selenium-binding protein which may be involved in the sensing of reactive xenobiotics in the cytopla

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05694	SBP56	6 → 472	56kDa selenium binding protein (SBP56)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two

Sequence

MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVI
HRLPMPNLKDELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHK
VIEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERP
GGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADVEAGLYGSHLYVWDWQRHEIVQ
TLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKG
WLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGP
VQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIRE
GSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI

Sequence length

472

Interactions

View interactions

	KEGG
	Sulfur metabolism Metabolic pathways

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Extra-Oral Halitosis	extraoral halitosis due to methanethiol oxidase deficiency	rs1553204817, rs1553204840, rs758495626, rs1357490520	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS

Show/Hide Text Mining Associations (62)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Inhibit	20332323
Adenocarcinoma Bronchiolo Alveolar	Inhibit	14991897
Adenocarcinoma of Lung	Associate	14991897, 34734491, 35205284
Arthritis Rheumatoid	Associate	24764015
Barrett Esophagus	Inhibit	20332323
Beta ketothiolase deficiency	Inhibit	14991897
Bradycardia	Associate	31450690
Brain Diseases	Associate	33603109
Breast Neoplasms	Inhibit	23704933
Bronchial Diseases	Associate	23977169
Carcinogenesis	Associate	21143902, 36253721
Carcinoma Hepatocellular	Associate	32443734, 34493740
Carcinoma Non Small Cell Lung	Inhibit	37606338
Carcinoma Renal Cell	Associate	25227434
Carcinoma Squamous Cell	Inhibit	26956891
Cell Transformation Neoplastic	Associate	26956891
Colorectal Neoplasms	Associate	36253721
Death	Inhibit	25227434, 35205284
Death	Associate	31450690
Drug Related Side Effects and Adverse Reactions	Stimulate	20332323
Drug Related Side Effects and Adverse Reactions	Associate	26593911
Glomerulonephritis IGA	Stimulate	39488256
Head and Neck Neoplasms	Associate	27583873
Heart Arrest	Associate	31450690
Hypoxia	Associate	31450690
Immune System Diseases	Associate	36253721
Immunologic Deficiency Syndromes	Associate	20332323
Infections	Associate	15115286
Inflammation	Associate	23968978, 39488256
Irritable Bowel Syndrome	Associate	33011346
Lymphatic Metastasis	Inhibit	26956891
Melioidosis	Associate	31091290
Mental Disorders	Associate	23272063
Mesangial sclerosis diffuse	Associate	39488256
Mitochondrial Diseases	Associate	26593911
Mouth Diseases	Associate	23977169
Muscle Neoplasms	Associate	25532418
Myocardial Infarction	Associate	31450690
Myocardial Ischemia	Associate	31450690
Nasopharyngeal Carcinoma	Associate	27583873
Neoplasms	Inhibit	25227434, 25993660, 26593911, 27583873, 31918717, 32443734, 37606338
Neoplasms	Associate	34190025, 36253721
Neoplasms Glandular and Epithelial	Inhibit	23977169
Neoplasms Squamous Cell	Associate	23977169, 36718148
Neuronal Ceroid Lipofuscinoses	Associate	35506243
Oculocutaneous albinism type 2	Associate	37606338
Parkinson Disease	Associate	36430645
Personality Disorders	Associate	26847995
Personality Disorders	Inhibit	36253721
Precancerous Conditions	Inhibit	23977169
Precancerous Conditions	Associate	26956891
Prostatic Neoplasms	Inhibit	21143902
Prostatic Neoplasms	Associate	25871394, 25993660, 26847995, 32511787
Prostatic Neoplasms Castration Resistant	Associate	25871394
Psoriasis	Associate	30092825
Psychological Distress	Associate	31450690
Rectal Neoplasms	Associate	37548833
Segmental glomerulosclerosis	Stimulate	39488256
Soft Tissue Injuries	Associate	39488256
Squamous Cell Carcinoma of Head and Neck	Inhibit	27583873
Thyroid Cancer Papillary	Associate	16788983
Urinary Bladder Neoplasms	Inhibit	31918717

SELENBP1 (selenium binding protein 1)