Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	89884
Gene name Gene Name - the full gene name approved by the HGNC.	LIM homeobox 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LHX4
Synonyms (NCBI Gene) Gene synonyms aliases	CPHD4
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CPHD4
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q25.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor involved in the control of differentiation and development of the pituitary gland

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587776662	->C	Pathogenic	Coding sequence variant, frameshift variant
rs886041420	A>-	Pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023725	hsa-miR-1-3p	Microarray	18668037
MIRT702277	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT702276	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT702275	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT702274	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT702273	hsa-miR-4459	HITS-CLIP	23313552
MIRT702272	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT702271	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT702270	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT702269	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT702268	hsa-miR-4470	HITS-CLIP	23313552
MIRT702267	hsa-miR-3926	HITS-CLIP	23313552
MIRT702266	hsa-miR-3688-5p	HITS-CLIP	23313552
MIRT702265	hsa-miR-548s	HITS-CLIP	23313552
MIRT623391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT623390	hsa-miR-3605-5p	HITS-CLIP	23824327
MIRT623389	hsa-miR-4313	HITS-CLIP	23824327
MIRT656745	hsa-miR-6894-5p	HITS-CLIP	23824327
MIRT623391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT623390	hsa-miR-3605-5p	HITS-CLIP	23824327
MIRT656745	hsa-miR-6894-5p	HITS-CLIP	23824327
MIRT623391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT623390	hsa-miR-3605-5p	HITS-CLIP	23824327
MIRT623389	hsa-miR-4313	HITS-CLIP	23824327
MIRT576487	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT702276	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT702275	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT576486	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT576485	hsa-miR-4459	HITS-CLIP	23313552
MIRT576484	hsa-miR-4433a-3p	HITS-CLIP	23313552
MIRT576483	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT576482	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT576481	hsa-miR-4786-5p	HITS-CLIP	23313552
MIRT576480	hsa-miR-4470	HITS-CLIP	23313552
MIRT576479	hsa-miR-3926	HITS-CLIP	23313552
MIRT576478	hsa-miR-3688-5p	HITS-CLIP	23313552
MIRT576477	hsa-miR-548s	HITS-CLIP	23313552
MIRT623391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT623390	hsa-miR-3605-5p	HITS-CLIP	23824327
MIRT623389	hsa-miR-4313	HITS-CLIP	23824327
MIRT656745	hsa-miR-6894-5p	HITS-CLIP	23824327
MIRT623391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT623390	hsa-miR-3605-5p	HITS-CLIP	23824327
MIRT656745	hsa-miR-6894-5p	HITS-CLIP	23824327
MIRT623391	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT623390	hsa-miR-3605-5p	HITS-CLIP	23824327
MIRT623389	hsa-miR-4313	HITS-CLIP	23824327
MIRT2453014	hsa-miR-1294	CLIP-seq
MIRT2453015	hsa-miR-4316	CLIP-seq
MIRT2453016	hsa-miR-4446-3p	CLIP-seq
MIRT2453017	hsa-miR-4675	CLIP-seq
MIRT2453018	hsa-miR-4677-3p	CLIP-seq
MIRT2453019	hsa-miR-4741	CLIP-seq
MIRT2453020	hsa-miR-4753-5p	CLIP-seq
MIRT2453021	hsa-miR-4757-5p	CLIP-seq
MIRT2453022	hsa-miR-888	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	15998782
GO:0001890	Process	Placenta development	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 26871637, 27820671, 28514442, 31515488, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008045	Process	Motor neuron axon guidance	IEA
GO:0008327	Function	Methyl-CpG binding	IDA	28473536
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0021526	Process	Medial motor column neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA	21873635
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	28473536
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15998782
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
602146	21734	ENSG00000121454

Protein

UniProt ID

Q969G2

Protein name

LIM/homeobox protein Lhx4 (LIM homeobox protein 4)

Protein function

May play a critical role in the development of respiratory control mechanisms and in the normal growth and maturation of the lung. Binds preferentially to methylated DNA (PubMed:28473536).

PDB

5HOD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	30 → 85	LIM domain	Domain
PF00412	LIM	89 → 148	LIM domain	Domain
PF00046	Homeodomain	158 → 214	Homeodomain	Domain

Sequence

MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMQLADRCFSRAGSVYCKEDFFKRFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPT
SDISTGSSVGYPDFPTSPGSWLDEMDHPPF

Sequence length

390

Interactions

View interactions

Show/Hide Causal Diseases (12)

Disease term	Disease name	dbSNP ID	References
Causal
Agenesis of corpus callosum	Agenesis of corpus callosum	rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Diabetes insipidus	Diabetes Insipidus	rs781942628, rs104894747, rs104894748, rs104894749, rs104894750, rs28935496, rs2147483647, rs104894751, rs104894752, rs104894753, rs104894754, rs104894755, rs1569545523, rs104894756, rs104894757 View all (33 more)
Holoprosencephaly	Holoprosencephaly	rs121917878, rs121917879, rs121917880, rs1572624159, rs137853021, rs397515364, rs397515365, rs2147483647, rs121909067, rs121909070, rs199476093, rs28936675, rs104894044, rs104894045, rs104894040 View all (76 more)
Hypogonadotropic hypogonadism	Hypogonadotropic hypogonadism	rs104894702, rs104893836, rs104893837, rs104893842, rs121909628, rs138249161, rs1601946139
Hypothyroidism	Hypothyroidism, Hypothyroidism due to deficient transcription factors involved in pituitary development or function, Secondary hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)
Pituitary hormone deficiency	PITUITARY HORMONE DEFICIENCY, COMBINED, 4, Pituitary Hormone Deficiency, Combined, 1, Combined pituitary hormone deficiencies, genetic forms	rs104893754, rs104893756, rs104893757, rs104893759, rs104893760, rs104893761, rs104893762, rs587776798, rs104893758, rs104893763, rs104893764, rs104893765, rs587776799, rs104893766, rs370761964 View all (7 more)	17527005, 18073311, 23990694, 11567216, 18445675, 25955177, 25871839
Polydactyly	Polydactyly	rs1583729398, rs121917709, rs1583734240, rs121917714, rs397507422, rs398122899, rs587776959, rs386833752, rs1057518698, rs1060499558, rs755938967, rs1375768446, rs1309855392, rs1565601979, rs748321474 View all (3 more)
Short stature-pituitary and cerebellar defects-small sella turcica syndrome	Short stature-pituitary and cerebellar defects-small sella turcica syndrome	rs748268631, rs121912641, rs121912643, rs121912644, rs587776662, rs786204780

Show/Hide Unknown Diseases (3)

Disease term	Disease name	References	Source
Unknown
Pituitary stalk interruption syndrome	Pituitary stalk interruption syndrome	21270112	ClinVar
Pituitary Hormone Deficiency	combined pituitary hormone deficiencies, genetic form		GenCC
Pituitary Stalk Interruption Syndrome	pituitary stalk interruption syndrome		GenCC

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining
ACTH Deficiency Isolated	Associate	17527005, 25955177
Arnold Chiari Malformation	Associate	17527005
Cerebellar Diseases	Associate	11567216
Chromosome Aberrations	Associate	34124982
Colorectal Neoplasms	Stimulate	25034524
Combined Pituitary Hormone Deficiency	Associate	17527005, 25871839, 25955177, 32796691
Cryptorchidism	Associate	25871839
Death	Associate	25871839
Developmental Defects of Enamel	Associate	11567216
Empty Sella Syndrome	Associate	11567216, 17527005
Growth Disorders	Associate	11567216
Hemochromatosis	Associate	23761422, 25955177
Hereditary renal agenesis	Associate	25871839
Hypoglycemia	Associate	17527005
Hypopituitarism	Associate	25871839, 25955177, 34124982
Hypothyroidism	Associate	25955177
Neoplasms	Associate	25034524
Pituitary Diseases	Associate	11567216, 17527005, 25871839, 34124982
Pituitary Hormone Deficiency Combined 2	Associate	25871839
Pituitary Neoplasms	Associate	31745224
Pregnancy Ectopic	Associate	17527005
Respiratory Tract Diseases	Associate	17527005
Turner Syndrome	Associate	23761422
Wyburn Mason's syndrome	Associate	25871839

LHX4 (LIM homeobox 4)