Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
89884
Gene name Gene Name - the full gene name approved by the HGNC.
LIM homeobox 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LHX4
Synonyms (NCBI Gene) Gene synonyms aliases
CPHD4
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q25.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor involved in the control of differentiation and development of the pituitary gland
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587776662 ->C Pathogenic Coding sequence variant, frameshift variant
rs886041420 A>- Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023725 hsa-miR-1-3p Microarray 18668037
MIRT702277 hsa-miR-548as-3p HITS-CLIP 23313552
MIRT702276 hsa-miR-3614-5p HITS-CLIP 23313552
MIRT702275 hsa-miR-6500-3p HITS-CLIP 23313552
MIRT702274 hsa-miR-4768-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602146 21734 ENSG00000121454
Protein
UniProt ID Q969G2
Protein name LIM/homeobox protein Lhx4 (LIM homeobox protein 4)
Protein function May play a critical role in the development of respiratory control mechanisms and in the normal growth and maturation of the lung. Binds preferentially to methylated DNA (PubMed:28473536).
PDB 5HOD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 30 85 LIM domain Domain
PF00412 LIM 89 148 LIM domain Domain
PF00046 Homeodomain 158 214 Homeodomain Domain
Sequence
MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMQLADRCFSRAGSVYCKEDFFKRF
GTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLMEDGRLVCKEDYETAK
QNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKR
LKKDAGRHRWGQFYKSVKRSRGSSKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPT
SDISTGSSVGYPDFPTSPGSWLDEMDHPPF
Sequence length 390
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Short Stature-Pituitary And Cerebellar Defects-Small Sella Turcica Syndrome short stature-pituitary and cerebellar defects-small sella turcica syndrome rs121912643, rs121912644, rs587776662, rs786204780, rs748268631, rs121912641 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypothyroidism hypothyroidism due to deficient transcription factors involved in pituitary development or function N/A N/A GenCC
Pituitary Hormone Deficiency combined pituitary hormone deficiencies, genetic form, pituitary hormone deficiency, combined, 1 N/A N/A GenCC, ClinVar
Pituitary Stalk Interruption Syndrome pituitary stalk interruption syndrome N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
ACTH Deficiency Isolated Associate 17527005, 25955177
Arnold Chiari Malformation Associate 17527005
Cerebellar Diseases Associate 11567216
Chromosome Aberrations Associate 34124982
Colorectal Neoplasms Stimulate 25034524
Combined Pituitary Hormone Deficiency Associate 17527005, 25871839, 25955177, 32796691
Cryptorchidism Associate 25871839
Death Associate 25871839
Developmental Defects of Enamel Associate 11567216
Empty Sella Syndrome Associate 11567216, 17527005