Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	89874
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 25 member 21
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC25A21
Synonyms (NCBI Gene) Gene synonyms aliases	MTDPS18, ODC, ODC1
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1389068504	T>C	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT710658	hsa-miR-4666a-3p	HITS-CLIP	19536157
MIRT710657	hsa-miR-4289	HITS-CLIP	19536157
MIRT710656	hsa-miR-3611	HITS-CLIP	19536157
MIRT710655	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT495812	hsa-miR-3148	PAR-CLIP	22291592
MIRT495811	hsa-miR-4668-5p	PAR-CLIP	22291592
MIRT495812	hsa-miR-3148	PAR-CLIP	22291592
MIRT495811	hsa-miR-4668-5p	PAR-CLIP	22291592
MIRT495810	hsa-miR-625-5p	PAR-CLIP	22291592
MIRT710658	hsa-miR-4666a-3p	HITS-CLIP	19536157
MIRT710657	hsa-miR-4289	HITS-CLIP	19536157
MIRT710656	hsa-miR-3611	HITS-CLIP	19536157
MIRT710655	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT495812	hsa-miR-3148	PAR-CLIP	22291592
MIRT495811	hsa-miR-4668-5p	PAR-CLIP	22291592
MIRT495812	hsa-miR-3148	PAR-CLIP	22291592
MIRT495811	hsa-miR-4668-5p	PAR-CLIP	22291592
MIRT495810	hsa-miR-625-5p	PAR-CLIP	22291592
MIRT1355593	hsa-miR-1253	CLIP-seq
MIRT1355594	hsa-miR-298	CLIP-seq
MIRT1355595	hsa-miR-3618	CLIP-seq
MIRT1355596	hsa-miR-4433	CLIP-seq
MIRT1355597	hsa-miR-4434	CLIP-seq
MIRT1355598	hsa-miR-4459	CLIP-seq
MIRT1355599	hsa-miR-4516	CLIP-seq
MIRT1355600	hsa-miR-4768-3p	CLIP-seq
MIRT1355601	hsa-miR-4802-3p	CLIP-seq
MIRT1355602	hsa-miR-130a	CLIP-seq
MIRT1355603	hsa-miR-130b	CLIP-seq
MIRT1355604	hsa-miR-301a	CLIP-seq
MIRT1355605	hsa-miR-301b	CLIP-seq
MIRT1355606	hsa-miR-3152-3p	CLIP-seq
MIRT1355607	hsa-miR-3591-5p	CLIP-seq
MIRT1355608	hsa-miR-3653	CLIP-seq
MIRT1355609	hsa-miR-3658	CLIP-seq
MIRT1355610	hsa-miR-3666	CLIP-seq
MIRT1355611	hsa-miR-3673	CLIP-seq
MIRT1355612	hsa-miR-4282	CLIP-seq
MIRT1355613	hsa-miR-4295	CLIP-seq
MIRT1355614	hsa-miR-4325	CLIP-seq
MIRT1355615	hsa-miR-4473	CLIP-seq
MIRT1355616	hsa-miR-454	CLIP-seq
MIRT1355617	hsa-miR-4671-3p	CLIP-seq
MIRT1355618	hsa-miR-4799-5p	CLIP-seq
MIRT1355619	hsa-miR-578	CLIP-seq
MIRT1355620	hsa-miR-581	CLIP-seq
MIRT1922378	hsa-miR-4666-3p	CLIP-seq
MIRT1355593	hsa-miR-1253	CLIP-seq
MIRT1355596	hsa-miR-4433	CLIP-seq
MIRT1355597	hsa-miR-4434	CLIP-seq
MIRT1355598	hsa-miR-4459	CLIP-seq
MIRT1355599	hsa-miR-4516	CLIP-seq
MIRT1355600	hsa-miR-4768-3p	CLIP-seq
MIRT2329883	hsa-miR-1236	CLIP-seq
MIRT2329884	hsa-miR-3907	CLIP-seq
MIRT2329885	hsa-miR-409-3p	CLIP-seq
MIRT2329886	hsa-miR-4652-3p	CLIP-seq
MIRT2329887	hsa-miR-4778-3p	CLIP-seq
MIRT2442634	hsa-miR-2276	CLIP-seq
MIRT2442635	hsa-miR-4708-3p	CLIP-seq
MIRT2442636	hsa-miR-556-3p	CLIP-seq
MIRT2459589	hsa-miR-3129-3p	CLIP-seq
MIRT2459590	hsa-miR-3647-3p	CLIP-seq
MIRT2459591	hsa-miR-409-5p	CLIP-seq
MIRT2459592	hsa-miR-4428	CLIP-seq
MIRT2459593	hsa-miR-490-3p	CLIP-seq
MIRT2459594	hsa-miR-499-3p	CLIP-seq
MIRT2459595	hsa-miR-499a-3p	CLIP-seq
MIRT2459596	hsa-miR-548a-3p	CLIP-seq
MIRT2459597	hsa-miR-548e	CLIP-seq
MIRT2459598	hsa-miR-548f	CLIP-seq
MIRT2459599	hsa-miR-649	CLIP-seq
MIRT2442634	hsa-miR-2276	CLIP-seq
MIRT2442635	hsa-miR-4708-3p	CLIP-seq
MIRT2442636	hsa-miR-556-3p	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006554	Process	Lysine catabolic process	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IDA	11083877
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	IMP	29517768
GO:0015139	Function	Alpha-ketoglutarate transmembrane transporter activity	TAS
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:1990550	Process	Mitochondrial alpha-ketoglutarate transmembrane transport	IC	11083877
GO:1990550	Process	Mitochondrial alpha-ketoglutarate transmembrane transport	IMP	29517768

MIM	HGNC	e!Ensembl
607571	14411	ENSG00000183032

Protein

UniProt ID

Q9BQT8

Protein name

Mitochondrial 2-oxodicarboxylate carrier (ODC) (Mitochondrial 2-oxoadipate carrier) (Solute carrier family 25 member 21)

Protein function

Transports dicarboxylates across the inner membranes of mitochondria by a counter-exchange mechanism (PubMed:11083877). Can transport 2-oxoadipate (2-oxohexanedioate), 2-oxoglutarate, adipate (hexanedioate), glutarate, and to a lesser extent, pi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	11 → 104	Mitochondrial carrier protein	Family
PF00153	Mito_carr	107 → 201	Mitochondrial carrier protein	Family
PF00153	Mito_carr	204 → 299	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta, gall bladder and colon. {ECO:0000269|PubMed:11083877}.

Sequence

MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSF
RMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSG
LTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHG
VFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQP
VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW

Sequence length

299

Interactions

View interactions

	Reactome
			Lysine catabolism

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Mitochondrial DNA Depletion Syndrome	Mitochondrial DNA depletion syndrome 18	rs1389068504	N/A

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Barrett esophagus	Barrett's esophagus	N/A	N/A	GWAS
Breast cancer	Breast cancer	N/A	N/A	GWAS
Breast Cancer	Breast cancer (estrogen-receptor positive)	N/A	N/A	GWAS
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	24080446
Colorectal Neoplasms	Inhibit	37937641
Glioma	Associate	33498463, 34288803
Leukemia Myeloid Acute	Associate	35924822
Migraine Disorders	Associate	34294844
Mitochondrial Diseases	Associate	29517768
Mitochondrial Myopathies	Associate	29517768
Mitochondrial Phosphate Carrier Deficiency	Associate	29517768
Muscular Atrophy Spinal	Associate	29517768
Neoplasm Metastasis	Associate	37937641
Neoplasms	Inhibit	35444105, 37937641
Stomach Neoplasms	Inhibit	35444105

SLC25A21 (solute carrier family 25 member 21)