Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	89866
Gene name Gene Name - the full gene name approved by the HGNC.	SEC16 homolog B, endoplasmic reticulum export factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SEC16B
Synonyms (NCBI Gene) Gene synonyms aliases	LZTR2, PGPR-p117, RGPR, RGPR-p117, SEC16S
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q25.2
Summary Summary of gene provided in NCBI Entrez Gene.	SEC16B is a mammalian homolog of S. cerevisiae Sec16 that is required for organization of transitional endoplasmic reticulum (ER) sites and protein export (Bhattacharyya and Glick, 2007 [PubMed 17192411]).[supplied by OMIM, Jun 2009]

Show/Hide all(20)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017884	hsa-miR-335-5p	Microarray	18185580
MIRT1332491	hsa-miR-3184	CLIP-seq
MIRT1332492	hsa-miR-3192	CLIP-seq
MIRT1332493	hsa-miR-3529	CLIP-seq
MIRT1332494	hsa-miR-379	CLIP-seq
MIRT1332495	hsa-miR-423-5p	CLIP-seq
MIRT1332496	hsa-miR-4451	CLIP-seq
MIRT1332497	hsa-miR-4492	CLIP-seq
MIRT1332498	hsa-miR-4498	CLIP-seq
MIRT1332499	hsa-miR-4505	CLIP-seq
MIRT1332500	hsa-miR-4650-3p	CLIP-seq
MIRT1332501	hsa-miR-762	CLIP-seq
MIRT2323007	hsa-miR-3163	CLIP-seq
MIRT2323008	hsa-miR-3942-5p	CLIP-seq
MIRT2323009	hsa-miR-4703-5p	CLIP-seq
MIRT2394145	hsa-miR-3607-5p	CLIP-seq
MIRT2394146	hsa-miR-3944-5p	CLIP-seq
MIRT2394147	hsa-miR-4639-3p	CLIP-seq
MIRT2394148	hsa-miR-668	CLIP-seq
MIRT2394149	hsa-miR-767-3p	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	21478858, 22355596
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	21478858
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	22355596
GO:0006914	Process	Autophagy	IEA
GO:0007029	Process	Endoplasmic reticulum organization	IBA	21873635
GO:0007029	Process	Endoplasmic reticulum organization	IDA	21768384
GO:0007030	Process	Golgi organization	IBA	21873635
GO:0007031	Process	Peroxisome organization	IDA	21768384
GO:0010628	Process	Positive regulation of gene expression	IMP	21768384
GO:0012507	Component	ER to Golgi transport vesicle membrane	IBA	21873635
GO:0015031	Process	Protein transport	IEA
GO:0016559	Process	Peroxisome fission	IMP	21768384
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	21768384
GO:0048208	Process	COPII vesicle coating	IBA	21873635
GO:0048208	Process	COPII vesicle coating	TAS
GO:0070863	Process	Positive regulation of protein exit from endoplasmic reticulum	IBA	21873635
GO:0070863	Process	Positive regulation of protein exit from endoplasmic reticulum	IMP	21768384
GO:0070971	Component	Endoplasmic reticulum exit site	IBA	21873635
GO:0070971	Component	Endoplasmic reticulum exit site	IDA	21478858, 22355596
GO:0070973	Process	Protein localization to endoplasmic reticulum exit site	IBA	21873635

MIM	HGNC	e!Ensembl
612855	30301	ENSG00000120341

Protein

UniProt ID

Q96JE7

Protein name

Protein transport protein Sec16B (Leucine zipper transcription regulator 2) (Regucalcin gene promoter region-related protein p117) (RGPR-p117) (SEC16 homolog B)

Protein function

Plays a role in the organization of the endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER). Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus (PubMed:17192411,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12932	Sec16	279 → 378	Vesicle coat trafficking protein Sec16 mid-region	Domain
PF12931	Sec16_C	445 → 715	Sec23-binding domain of Sec16	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12244571, ECO:0000269|PubMed:17192411}.

Sequence

MELWAPQRLPQTRGKATAPSKDPDRGFRRDGHHRPVPHSWHNGERFHQWQDNRGSPQPQQ
EPRADHQQQPHYASRPGDWHQPVSGVDYYEGGYRNQLYSRPGYENSYQSYQSPTMREEYA
YGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSN
SRNPCKDSPASNSGQEWPGELFPGSLLAEAQKNKPSLASESNLLQQRESGLSSSSYELSQ
YIRDAPERDDPPASAAWSPVQADVSSAGPKAPMKFYIPHVPVSFGPGGQLVHVGPSSPTD
GQAALVELHSMEVILNDSEEQEEMRSFSGPLIREDVHKVDIMTFCQQKAAQSCKSETLGS
RDSALLWQLLVLLCRQNGSMVGSDIAELLMQDCKKLEKYKRQPPVANLINLTDEDWPVLS
SGTPNLLTGEIPPSVETPAQIVEKFTRLLYYGRKKEALEWAMKNHLWGHALFLSSKMDPQ
TYSWVMSGFTSTLALNDPLQTLFQLMSGRIPQAATCCGEKQWGDWRPHLAVILSNQAGDP
ELYQRAIVAIGDTLAGKGLVEAAHFCYLMAHVPFGHYTVKTDHLVLLGSSHSQEFLKFAT
TEAIQRTEIFEYCQMLGRPKSFIPSFQVYKLLYASRLADYGLVSQALHYCEAIGAAVLSQ
GESSHPVLLVELIKLAEKLKLSDPLVLERRSGDRDLEPDWLAQLRRQLEQKVAGDIGDPH
PTRSDISGAGGTTTENTFYQDFSGCQGYSEAPGYRSALWLTPEQTCLLQPSPQQPFPLQP
GSYPAGGGAGQTGTPRPFYSVPETHLPGTGSSVAVTEATGGTVWEEMLQTHLGPGENTVS
QETSQPPDGQEVISKPQTPLAARPRSISESSASSAKEDEKESSDEADKNSPRNTAQRGKL
GDGKEHTKSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLSLTP
SPESPPLPDVSAFSRGRGGGEGRGSASSGGAAAGAGVGGLSGPESVSFELCSNPGVLLPP
PALKGAVPLYNPSQVPQLPTATSLNRPNRLAQRRYPTQPC

Sequence length

1060

Interactions

View interactions

	Reactome
			COPII-mediated vesicle transport

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	22484627

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome		GWAS
Schizophrenia	Schizophrenia		GWAS
Diabetes	Diabetes		GWAS
Gout	Gout		GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	29436922
Diabetes Mellitus Type 2	Associate	20712903
Endometrial Neoplasms	Associate	21976109
Genu Varum	Associate	36916446
Glucocorticoid Receptor Deficiency	Associate	30026463
Growth Disorders	Associate	36916446
Insulin Resistance	Associate	32260174
Muscle Hypotonia	Associate	36916446
Obesity	Associate	20616199, 20712903, 21779088, 21796137, 21976109, 23349760, 23408508, 23950976, 26800887, 27421018, 31936053, 33668547, 33801339, 34836030, 36839421, 37709841 View all (1 more)
Osteogenesis Imperfecta	Associate	36916446
Overweight	Associate	35295960
Spondylocostal dysostosis autosomal recessive	Associate	36916446

SEC16B (SEC16 homolog B, endoplasmic reticulum export factor)