ATG16L2 (autophagy related 16 like 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 89849
Gene name Autophagy related 16 like 2
Gene symbol ATG16L2
Synonyms (NCBI Gene)
ATG16BWDR80
Chromosome 11
Chromosome location 11q13.4
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT017121 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0000045 Process Autophagosome assembly ISO
GO:0000045 Process Autophagosome assembly ISS
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005776 Component Autophagosome ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
618716 25464 ENSG00000168010
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NAA4
Protein name Protein Atg16l2 (APG16-like 2) (Autophagy-related protein 16-2) (WD repeat-containing protein 80)
Protein function May play a role in regulating epithelial homeostasis in an ATG16L1-dependent manner.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08614 ATG16 17 → 207 Autophagy protein 16 (ATG16) Coiled-coil
PF00400 WD40 327 → 364 WD domain, G-beta repeat Repeat
PF00400 WD40 412 → 450 WD domain, G-beta repeat Repeat
PF00400 WD40 493 → 530 WD domain, G-beta repeat Repeat
PF00400 WD40 537 → 576 WD domain, G-beta repeat Repeat
Sequence 
MAGPGVPGAPAARWKRHIVRQLRLRDRTQKALFLELVPAYNHLLEKAELLDKFSKKLQPE
PNSVTPTTHQGPWEESELDSDQVPSLVALRVKWQEEEEGLRLVCGEMAYQVVEKGAALGT
LESELQQRQSRLAALEARVAQLREARAQQAQQVEEWRAQNAVQRAAYEALRAHVGLREAA
LRRLQEEARDLLERLVQRKARAAAERNLRNERRERAKQARVSQELKKAAKRTVSISEGPD
TLGDGMRERRETLALAPEPEPLEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKR
RGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNSSLLATGGADRLI
HLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSG
HKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVCGDHIIISGH
NDQKIRFWDSRGPHCTQVIPVQGRVTSLSLSHDQLHLLSCSRDNTLKVIDLRVSNIRQVF
RADGFKCGSDWTKAVFSPDRSYALAGSCDGALYIWDVDTGKLESRLQGPHCAAVNAVAWC
YSGSHMVSVDQGRKVVLWQ
Sequence length 619
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Autophagy - animal  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Colon adenocarcinoma Uncertain significance rs774719029 RCV005932329
Colorectal cancer Uncertain significance rs774719029 RCV005932331
Familial cancer of breast Uncertain significance rs774719029 RCV005932328
Hepatocellular carcinoma Uncertain significance rs774719029 RCV005932330
Show/Hide Text Mining Associations (14)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 29259263
Alzheimer Disease Associate 40244264
Amyotrophic Lateral Sclerosis Associate 33523907
Carcinoma Non Small Cell Lung Associate 29454863
Carcinoma Renal Cell Associate 31626592
Coronary Artery Disease Associate 32514122
Crohn Disease Associate 26503572
Drug Related Side Effects and Adverse Reactions Associate 31692259
Kidney Neoplasms Associate 26208877
Lung Neoplasms Associate 32514122