Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
89781
Gene name Gene Name - the full gene name approved by the HGNC.
HPS4 biogenesis of lysosomal organelles complex 3 subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HPS4
Synonyms (NCBI Gene) Gene synonyms aliases
BLOC3S2, LE
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein component of biogenesis of lysosome-related organelles complexes (BLOC). BLOC complexes are important for the formation of endosomal-lysosomal organelles such as melanosomes and platelet dense granules. Mutations in this gene r
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs61729175 G>A Conflicting-interpretations-of-pathogenicity 5 prime UTR variant, coding sequence variant, non coding transcript variant, genic upstream transcript variant, missense variant
rs119471021 G>A Pathogenic Coding sequence variant, stop gained, non coding transcript variant, intron variant
rs119471022 G>A,T Pathogenic Stop gained, 5 prime UTR variant, non coding transcript variant, genic upstream transcript variant, missense variant, coding sequence variant
rs119471023 G>A,C Pathogenic Stop gained, 5 prime UTR variant, non coding transcript variant, genic upstream transcript variant, upstream transcript variant, missense variant, coding sequence variant
rs119471024 C>A Pathogenic Stop gained, 5 prime UTR variant, non coding transcript variant, genic upstream transcript variant, upstream transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002809 hsa-miR-1-3p Microarray 15685193
MIRT002809 hsa-miR-1-3p Microarray 15685193
MIRT002809 hsa-miR-1-3p Microarray 18668037
MIRT029994 hsa-miR-26b-5p Microarray 19088304
MIRT035919 hsa-miR-1180-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005085 Function Guanyl-nucleotide exchange factor activity IBA
GO:0005085 Function Guanyl-nucleotide exchange factor activity IDA 23084991
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005515 Function Protein binding IPI 12756248, 20048159, 23084991
GO:0005737 Component Cytoplasm IDA 12756248
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606682 15844 ENSG00000100099
Protein
UniProt ID Q9NQG7
Protein name BLOC-3 complex member HPS4 (Hermansky-Pudlak syndrome 4 protein) (Light-ear protein homolog)
Protein function Component of the BLOC-3 complex, a complex that acts as a guanine exchange factor (GEF) for RAB32 and RAB38, promotes the exchange of GDP to GTP, converting them from an inactive GDP-bound form into an active GTP-bound form. The BLOC-3 complex p
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF19031 Intu_longin_1 15 121 First Longin domain of INTU, CCZ1 and HPS4 Domain
PF19033 Intu_longin_3 598 699 Intu longin-like domain 3 Domain
Sequence
MATSTSTEAKSASWWNYFFLYDGSKVKEEGDPTRAGICYFYPSQTLLDQQELLCGQIAGV
VRCVSDISDSPPTLVRLRKLKFAIKVDGDYLWVLGCAVELPDVSCKRFLDQLVGFFNFYN
G
PVSLAYENCSQEELSTEWDTFIEQILKNTSDLHKIFNSLWNLDQTKVEPLLLLKAARIL
QTCQRSPHILAGCILYKGLIVSTQLPPSLTAKVLLHRTAPQEQRLPTGEDAPQEHGAALP
PNVQIIPVFVTKEEAISLHEFPVEQMTRSLASPAGLQDGSAQHHPKGGSTSALKENATGH
VESMAWTTPDPTSPDEACPDGRKENGCLSGHDLESIRPAGLHNSARGEVLGLSSSLGKEL
VFLQEELDLSEIHIPEAQEVEMASGHFAFLHVPVPDGRAPYCKASLSASSSLEPTPPEDT
AISSLRPPSAPEMLTQHGAQEQLEDHPGHSSQAPIPRADPLPRRTRRPLLLPRLDPGQRG
NKLPTGEQGLDEDVDGVCESHAAPGLECSSGSANCQGAGPSADGISSRLTPAESCMGLVR
MNLYTHCVKGLVLSLLAEEPLLGDSAAIEEVYHSSLASLNGLEVHLKETLPRDEAASTSS
TYNFTHYDRIQSLLMANLPQVATPQDRRFLQAVSLMHSEFAQLPALYEMTVRNASTAVYA
CCNPIQETYFQQLAPAARSSGFPNPQDGAFSLSGKAKQK
LLKHGVNLL
Sequence length 708
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RAB GEFs exchange GTP for GDP on RABs
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hermansky-Pudlak Syndrome hermansky-pudlak syndrome 4 rs119471024, rs119471025, rs369053765, rs372020804, rs119471021, rs281865100, rs281865097, rs119471022, rs119471023 N/A
hermansky-pudlak syndrome Hermansky-Pudlak syndrome rs369053765, rs1602079277, rs119471023 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hermansky-Pudlak Syndrome With Pulmonary Fibrosis Hermansky-Pudlak syndrome with pulmonary fibrosis N/A N/A GenCC
Interstitial Lung Disease Interstitial lung disease 2 N/A N/A ClinVar
Ischemic Stroke Ischemic stroke N/A N/A GWAS
oculocutaneous albinism Oculocutaneous albinism N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Albinism Associate 35488210
Albinism Oculocutaneous Associate 18463683, 30791930
Hermanski Pudlak Syndrome Associate 29600982, 30791930, 30990103, 31415434, 33536261, 34608437, 36672886
Hypomagnesemia primary Associate 21833017
Inflammatory Bowel Diseases Associate 33423334
Lung Diseases Associate 31415434
Pigmentation Disorders Associate 23084991
Pulmonary Fibrosis Associate 31415434, 33536261
Respiratory Insufficiency Associate 31415434
Schizophrenia Associate 24168225