Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	89780
Gene name Gene Name - the full gene name approved by the HGNC.	Wnt family member 3A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WNT3A
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q42.13
Summary Summary of gene provided in NCBI Entrez Gene.	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all(165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000282	hsa-miR-15a-5p	Luciferase reporter assay	18931683
MIRT003430	hsa-miR-16-5p	Luciferase reporter assay	18931683
MIRT003430	hsa-miR-16-5p	Review	20130964
MIRT000282	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	21106054
MIRT000282	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	21106054
MIRT000282	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR	21106054
MIRT021725	hsa-miR-132-3p	Microarray	17612493
MIRT021973	hsa-miR-128-3p	Microarray	17612493
MIRT025061	hsa-miR-181a-5p	Microarray	17612493
MIRT027132	hsa-miR-103a-3p	Sequencing	20371350
MIRT003430	hsa-miR-16-5p	Sequencing	20371350
MIRT736324	hsa-miR-1236-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, In situ hybridization, Flow cytometry	33133267
MIRT755445	hsa-miR-503-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36555553
MIRT1493676	hsa-miR-103a	CLIP-seq
MIRT1493677	hsa-miR-107	CLIP-seq
MIRT1493678	hsa-miR-1224-3p	CLIP-seq
MIRT1493679	hsa-miR-1255a	CLIP-seq
MIRT1493680	hsa-miR-1255b	CLIP-seq
MIRT1493681	hsa-miR-1260	CLIP-seq
MIRT1493682	hsa-miR-1260b	CLIP-seq
MIRT1493683	hsa-miR-1280	CLIP-seq
MIRT1493684	hsa-miR-1304	CLIP-seq
MIRT1493685	hsa-miR-138	CLIP-seq
MIRT1493686	hsa-miR-1469	CLIP-seq
MIRT1493687	hsa-miR-1587	CLIP-seq
MIRT1493688	hsa-miR-15a	CLIP-seq
MIRT1493689	hsa-miR-15b	CLIP-seq
MIRT1493690	hsa-miR-16	CLIP-seq
MIRT1493691	hsa-miR-1827	CLIP-seq
MIRT1493692	hsa-miR-195	CLIP-seq
MIRT1493693	hsa-miR-2110	CLIP-seq
MIRT1493694	hsa-miR-2467-3p	CLIP-seq
MIRT1493695	hsa-miR-298	CLIP-seq
MIRT1493696	hsa-miR-3074-5p	CLIP-seq
MIRT1493697	hsa-miR-3143	CLIP-seq
MIRT1493698	hsa-miR-3144-5p	CLIP-seq
MIRT1493699	hsa-miR-3150a-3p	CLIP-seq
MIRT1493700	hsa-miR-3158-5p	CLIP-seq
MIRT1493701	hsa-miR-3179	CLIP-seq
MIRT1493702	hsa-miR-3186-5p	CLIP-seq
MIRT1493703	hsa-miR-3201	CLIP-seq
MIRT1493704	hsa-miR-3202	CLIP-seq
MIRT1493705	hsa-miR-339-5p	CLIP-seq
MIRT1493706	hsa-miR-3605-5p	CLIP-seq
MIRT1493707	hsa-miR-3652	CLIP-seq
MIRT1493708	hsa-miR-3681	CLIP-seq
MIRT1493709	hsa-miR-3936	CLIP-seq
MIRT1493710	hsa-miR-410	CLIP-seq
MIRT1493711	hsa-miR-424	CLIP-seq
MIRT1493712	hsa-miR-4417	CLIP-seq
MIRT1493713	hsa-miR-4430	CLIP-seq
MIRT1493714	hsa-miR-4450	CLIP-seq
MIRT1493715	hsa-miR-4456	CLIP-seq
MIRT1493716	hsa-miR-4492	CLIP-seq
MIRT1493717	hsa-miR-4498	CLIP-seq
MIRT1493718	hsa-miR-4505	CLIP-seq
MIRT1493719	hsa-miR-4520a-3p	CLIP-seq
MIRT1493720	hsa-miR-4520b-3p	CLIP-seq
MIRT1493721	hsa-miR-4524	CLIP-seq
MIRT1493722	hsa-miR-4651	CLIP-seq
MIRT1493723	hsa-miR-4656	CLIP-seq
MIRT1493724	hsa-miR-4675	CLIP-seq
MIRT1493725	hsa-miR-4680-3p	CLIP-seq
MIRT1493726	hsa-miR-4711-5p	CLIP-seq
MIRT1493727	hsa-miR-4741	CLIP-seq
MIRT1493728	hsa-miR-4764-3p	CLIP-seq
MIRT1493729	hsa-miR-4786-3p	CLIP-seq
MIRT1493730	hsa-miR-4791	CLIP-seq
MIRT1493731	hsa-miR-490-5p	CLIP-seq
MIRT1493732	hsa-miR-497	CLIP-seq
MIRT1493733	hsa-miR-503	CLIP-seq
MIRT1493734	hsa-miR-5095	CLIP-seq
MIRT1493735	hsa-miR-541	CLIP-seq
MIRT1493736	hsa-miR-543	CLIP-seq
MIRT1493737	hsa-miR-548aa	CLIP-seq
MIRT1493738	hsa-miR-600	CLIP-seq
MIRT1493739	hsa-miR-608	CLIP-seq
MIRT1493740	hsa-miR-646	CLIP-seq
MIRT1493741	hsa-miR-654-5p	CLIP-seq
MIRT1493742	hsa-miR-762	CLIP-seq
MIRT2148789	hsa-miR-1225-3p	CLIP-seq
MIRT1493688	hsa-miR-15a	CLIP-seq
MIRT1493689	hsa-miR-15b	CLIP-seq
MIRT1493690	hsa-miR-16	CLIP-seq
MIRT2148790	hsa-miR-1915	CLIP-seq
MIRT1493692	hsa-miR-195	CLIP-seq
MIRT2148791	hsa-miR-2355-5p	CLIP-seq
MIRT1493701	hsa-miR-3179	CLIP-seq
MIRT1493703	hsa-miR-3201	CLIP-seq
MIRT1493704	hsa-miR-3202	CLIP-seq
MIRT2148792	hsa-miR-3929	CLIP-seq
MIRT1493711	hsa-miR-424	CLIP-seq
MIRT2148793	hsa-miR-4270	CLIP-seq
MIRT2148794	hsa-miR-4313	CLIP-seq
MIRT2148795	hsa-miR-4419b	CLIP-seq
MIRT2148796	hsa-miR-4441	CLIP-seq
MIRT2148797	hsa-miR-4478	CLIP-seq
MIRT1493722	hsa-miR-4651	CLIP-seq
MIRT2148798	hsa-miR-4726-3p	CLIP-seq
MIRT2148799	hsa-miR-4758-3p	CLIP-seq
MIRT1493730	hsa-miR-4791	CLIP-seq
MIRT1493732	hsa-miR-497	CLIP-seq
MIRT1493739	hsa-miR-608	CLIP-seq
MIRT1493676	hsa-miR-103a	CLIP-seq
MIRT1493677	hsa-miR-107	CLIP-seq
MIRT1493688	hsa-miR-15a	CLIP-seq
MIRT1493689	hsa-miR-15b	CLIP-seq
MIRT1493690	hsa-miR-16	CLIP-seq
MIRT1493692	hsa-miR-195	CLIP-seq
MIRT2369181	hsa-miR-3117-5p	CLIP-seq
MIRT1493697	hsa-miR-3143	CLIP-seq
MIRT2369182	hsa-miR-3150b-3p	CLIP-seq
MIRT1493703	hsa-miR-3201	CLIP-seq
MIRT2369183	hsa-miR-3619-3p	CLIP-seq
MIRT1493708	hsa-miR-3681	CLIP-seq
MIRT2369184	hsa-miR-3925-3p	CLIP-seq
MIRT1493710	hsa-miR-410	CLIP-seq
MIRT1493711	hsa-miR-424	CLIP-seq
MIRT2369185	hsa-miR-4258	CLIP-seq
MIRT2369186	hsa-miR-4433	CLIP-seq
MIRT2369187	hsa-miR-4459	CLIP-seq
MIRT1493719	hsa-miR-4520a-3p	CLIP-seq
MIRT1493720	hsa-miR-4520b-3p	CLIP-seq
MIRT1493721	hsa-miR-4524	CLIP-seq
MIRT2369188	hsa-miR-4661-5p	CLIP-seq
MIRT2369189	hsa-miR-4704-5p	CLIP-seq
MIRT1493726	hsa-miR-4711-5p	CLIP-seq
MIRT1493728	hsa-miR-4764-3p	CLIP-seq
MIRT2369190	hsa-miR-4768-3p	CLIP-seq
MIRT2369191	hsa-miR-4784	CLIP-seq
MIRT1493730	hsa-miR-4791	CLIP-seq
MIRT1493732	hsa-miR-497	CLIP-seq
MIRT1493733	hsa-miR-503	CLIP-seq
MIRT2369192	hsa-miR-515-5p	CLIP-seq
MIRT1493736	hsa-miR-543	CLIP-seq
MIRT1493737	hsa-miR-548aa	CLIP-seq
MIRT1493740	hsa-miR-646	CLIP-seq
MIRT2369193	hsa-miR-766	CLIP-seq
MIRT2148789	hsa-miR-1225-3p	CLIP-seq
MIRT2397022	hsa-miR-1247	CLIP-seq
MIRT2397023	hsa-miR-198	CLIP-seq
MIRT2397024	hsa-miR-4685-5p	CLIP-seq
MIRT2397025	hsa-miR-939	CLIP-seq
MIRT2148789	hsa-miR-1225-3p	CLIP-seq
MIRT2463531	hsa-miR-1289	CLIP-seq
MIRT2148790	hsa-miR-1915	CLIP-seq
MIRT2463532	hsa-miR-3690	CLIP-seq
MIRT2463533	hsa-miR-370	CLIP-seq
MIRT2463534	hsa-miR-4254	CLIP-seq
MIRT2463535	hsa-miR-4323	CLIP-seq
MIRT2463536	hsa-miR-4476	CLIP-seq
MIRT2463537	hsa-miR-4533	CLIP-seq
MIRT2463538	hsa-miR-4633-3p	CLIP-seq
MIRT2463539	hsa-miR-4668-5p	CLIP-seq
MIRT2463540	hsa-miR-4749-3p	CLIP-seq
MIRT2148799	hsa-miR-4758-3p	CLIP-seq
MIRT2463541	hsa-miR-4793-5p	CLIP-seq
MIRT2662772	hsa-miR-1266	CLIP-seq
MIRT2148793	hsa-miR-4270	CLIP-seq
MIRT2148796	hsa-miR-4441	CLIP-seq
MIRT2662773	hsa-miR-4518	CLIP-seq
MIRT2662772	hsa-miR-1266	CLIP-seq
MIRT2148793	hsa-miR-4270	CLIP-seq
MIRT2148796	hsa-miR-4441	CLIP-seq
MIRT2662773	hsa-miR-4518	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
FOXQ1	Activation	20145154

Show/Hide all(128)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001756	Process	Somitogenesis	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001947	Process	Heart looping	IEA
GO:0002092	Process	Positive regulation of receptor internalization	IDA	16890161
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	20093360
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005515	Function	Protein binding	IPI	19072540, 20393562, 21944579, 22682250, 22726442, 22784633, 24768165, 26908622, 33961781, 36994853
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	26902720
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007368	Process	Determination of left/right symmetry	IEA
GO:0007409	Process	Axonogenesis	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007498	Process	Mesoderm development	IEA
GO:0007507	Process	Heart development	IDA	19736317
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0010387	Process	COP9 signalosome assembly	IEA
GO:0010387	Process	COP9 signalosome assembly	ISS
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	26687115
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021527	Process	Spinal cord association neuron differentiation	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021846	Process	Cell proliferation in forebrain	IEA
GO:0021846	Process	Cell proliferation in forebrain	ISS
GO:0021874	Process	Wnt signaling pathway involved in forebrain neuroblast division	IEA
GO:0021904	Process	Dorsal/ventral neural tube patterning	IEA
GO:0022008	Process	Neurogenesis	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030879	Process	Mammary gland development	IEA
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0030901	Process	Midbrain development	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0033278	Process	Cell proliferation in midbrain	IEA
GO:0033278	Process	Cell proliferation in midbrain	TAS	24431302
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0036465	Process	Synaptic vesicle recycling	TAS	22988876
GO:0039706	Function	Co-receptor binding	IPI	20093360
GO:0042100	Process	B cell proliferation	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045202	Component	Synapse	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045445	Process	Myoblast differentiation	IEA
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20723538
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048018	Function	Receptor ligand activity	IDA	19736317, 20723538, 28733458
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048103	Process	Somatic stem cell division	IEA
GO:0048337	Process	Positive regulation of mesodermal cell fate specification	IDA	20559569
GO:0048343	Process	Paraxial mesodermal cell fate commitment	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048643	Process	Positive regulation of skeletal muscle tissue development	IEA
GO:0048697	Process	Positive regulation of collateral sprouting in absence of injury	IEA
GO:0048843	Process	Negative regulation of axon extension involved in axon guidance	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0050768	Process	Negative regulation of neurogenesis	ISS
GO:0050770	Process	Regulation of axonogenesis	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050807	Process	Regulation of synapse organization	IDA	18986540
GO:0050807	Process	Regulation of synapse organization	IMP	18986540
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	16890161, 18941195, 19101069, 19736317, 20137080, 20559569, 20723538, 23797875, 28733458
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	26902720
GO:0060070	Process	Canonical Wnt signaling pathway	TAS	22988876
GO:0060923	Process	Cardiac muscle cell fate commitment	IDA	20559569
GO:0060923	Process	Cardiac muscle cell fate commitment	IEA
GO:0061184	Process	Positive regulation of dermatome development	IDA	10654605
GO:0062009	Process	Secondary palate development	IMP	18413325
GO:0070062	Component	Extracellular exosome	TAS
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0070527	Process	Platelet aggregation	IEA
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0090245	Process	Axis elongation involved in somitogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	20723538
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090676	Process	Calcium ion transmembrane transport via low voltage-gated calcium channel	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IDA	18986540
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IMP	18986540
GO:0099054	Process	Presynapse assembly	TAS	24449494
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1904339	Process	Negative regulation of dopaminergic neuron differentiation	IEA
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	TAS	22988876
GO:1905539	Process	Regulation of postsynapse to nucleus signaling pathway	IEA
GO:1905606	Process	Regulation of presynapse assembly	IDA	19883499
GO:1905606	Process	Regulation of presynapse assembly	IMP	19883499
GO:1990851	Component	Wnt-Frizzled-LRP5/6 complex	IDA	20093360
GO:2000049	Process	Positive regulation of cell-cell adhesion mediated by cadherin	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IEA
GO:2000727	Process	Positive regulation of cardiac muscle cell differentiation	IDA	20559569
GO:2001141	Process	Regulation of RNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
606359	15983	ENSG00000154342

Protein

UniProt ID

P56704

Protein name

Protein Wnt-3a

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (PubMed:20093360, PubMed:21244856,

PDB

7DRT , 7URD , 7URE , 8TZR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	44 → 352	wnt family	Family

Tissue specificity

TISSUE SPECIFICITY: Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate. {ECO:0000269|PubMed:11414706}.

Sequence

MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK

Sequence length

352

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer MicroRNAs in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		TCF dependent signaling in response to WNT WNT ligand biogenesis and trafficking Disassembly of the destruction complex and recruitment of AXIN to the membrane Regulation of FZD by ubiquitination RNF mutants show enhanced WNT signaling and proliferation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypertension	Hypertension, Hypertension (confirmatory factor analysis Factor 12)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (97)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Inhibit	30841855
Adenocarcinoma of Lung	Associate	27610375
Adenomatous Polyposis Coli	Associate	30072583
Alopecia	Associate	19141591
Anorectal Malformations	Associate	23127126
Asthma	Associate	31683769
Astrocytoma	Stimulate	26708597
Barrett Esophagus	Associate	26297437, 30841855
Bone Diseases	Associate	25999350, 32413029
Bone Diseases Metabolic	Associate	24584697
Breast Neoplasms	Associate	21113658, 23666756, 23861811, 34868337, 35508987
Bronchiolitis Obliterans Syndrome	Associate	33758171
Calcinosis Cutis	Stimulate	31903136
Carcinogenesis	Associate	34902334
Carcinoma Hepatocellular	Associate	22761862, 26577850, 26602384, 27076768, 28902357, 34902334
Carcinoma Non Small Cell Lung	Associate	35744950
Carcinoma Renal Cell	Associate	22610075, 23893409, 34781823
Carcinoma Squamous Cell	Associate	34257574
Chemical and Drug Induced Liver Injury	Associate	36569862
Cholangiocarcinoma	Associate	24549785, 37568083
Colorectal Neoplasms	Associate	21478268, 24324366, 24564183, 29135090, 30072583, 30569135, 31147591, 32893845, 36849492, 39519079
Coronary Artery Disease	Associate	27455246, 38139440
Coxa Magna	Associate	33542623
Crohn Disease	Associate	26512113
Diabetes Mellitus	Stimulate	29135090
Diabetes Mellitus Type 2	Associate	35436882
Diabetic Foot	Associate	34483150
Endometrial Neoplasms	Associate	29164582
Esophageal Squamous Cell Carcinoma	Associate	37210725
Fibrosarcoma	Associate	31740580
Fibrosis	Associate	34522168
Focal Dermal Hypoplasia	Associate	25464842
Gallbladder Neoplasms	Associate	34982425
Genetic Diseases Inborn	Associate	24817932
Genomic Instability	Associate	32397113
Glioblastoma	Associate	33857857
Glioma	Associate	26708597, 34657400
Hamartoma	Associate	21909471
Head and Neck Neoplasms	Associate	36555553
HEM dysplasia	Associate	29620724
Hepatitis B	Associate	27076768
Hirschsprung Disease	Associate	24817932
Idiopathic Pulmonary Fibrosis	Associate	18478089, 34522168
Idiopathic Pulmonary Fibrosis	Inhibit	26997628
Inflammation	Associate	35491409
Intervertebral Disc Degeneration	Associate	33090383
Joint Diseases	Associate	35436882
Leukemia	Associate	19035298, 24086728
Leukemia Biphenotypic Acute	Inhibit	17156404
Leukemia Myeloid Acute	Associate	19035298
Liver Cirrhosis	Associate	27076768
Lung Neoplasms	Associate	18215320
Lymphatic Metastasis	Associate	27076768
Mast Cell Activation Disorders	Associate	31683769
Melanoma	Associate	18563180, 22895053, 23869245, 24114839
Mouth Neoplasms	Associate	37203400
Multiple Myeloma	Associate	40650009
Muscular Dystrophy Duchenne	Associate	18021006
Myelodysplastic Syndromes	Associate	26025663, 32397113
Nasal Polyps	Associate	28059551, 30118173
Neoplasm Metastasis	Associate	26577850, 28902357, 30360026
Neoplasms	Associate	24564183, 25848952, 26577850, 26708597, 27076768, 28902357, 33857857, 33947326, 34902334, 35442371, 36233156, 36902090
Neoplasms	Stimulate	25715123, 26790955
Neuroblastoma	Associate	26517508, 29505958
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	23382209
Non alcoholic Fatty Liver Disease	Associate	27310371
Osteoarthritis	Associate	22127703
Osteoarthritis	Stimulate	23748413
Osteomyelitis	Associate	31871129, 34492499
Osteoporosis	Associate	32080087, 33629292, 33939331
Osteosarcoma	Stimulate	23291185
Osteosarcoma	Associate	32075661
Ovarian Neoplasms	Associate	25715123, 31740580
Periapical Periodontitis	Associate	31831777
Posterior Capsular Rupture Ocular	Associate	22876125
Precancerous Conditions	Associate	26227219
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	19035298
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	17156404, 19035298
Prostatic Neoplasms	Associate	22098624, 32413029, 33947326
Retinal Dysplasia	Inhibit	30841855
Rhabdomyosarcoma Alveolar	Associate	23999248
Sarcoma Ewing	Associate	23396968
Schimke immunoosseous dysplasia	Associate	22699664, 25849153
Scleroderma Systemic	Associate	22328118
Sjogren's Syndrome	Stimulate	34058801
Small Cell Lung Carcinoma	Associate	33572899
Squamous Cell Carcinoma of Head and Neck	Associate	20028760, 21393552
Stomach Neoplasms	Associate	28358374, 32570120, 32608501, 33450435, 33954199
Tertiary Lymphoid Structures	Associate	24564183
Thyroid Neoplasms	Associate	34951409, 35442371
Tn Syndrome	Associate	24209998
Triple Negative Breast Neoplasms	Associate	25848952, 36902090
Trophoblastic Neoplasms	Associate	16565489
Tuberculosis Pulmonary	Associate	36569862
Uterine Cervical Dysplasia	Associate	34257574
Uterine Cervical Neoplasms	Associate	29079964
Virus Diseases	Associate	38203386

WNT3A (Wnt family member 3A)