Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8974
Gene name Gene Name - the full gene name approved by the HGNC.
Prolyl 4-hydroxylase subunit alpha 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
P4HA2
Synonyms (NCBI Gene) Gene synonyms aliases
MYP25, lncRNA-PE
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MYP25
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part o
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs758872875 C>T Pathogenic Missense variant, coding sequence variant
rs764211125 T>A,C Pathogenic Coding sequence variant, missense variant
rs1135402746 AC>- Pathogenic Coding sequence variant, intron variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005168 hsa-miR-30a-5p pSILAC 18668040
MIRT021377 hsa-miR-9-5p Microarray 17612493
MIRT005168 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT1209148 hsa-miR-129-5p CLIP-seq
MIRT1209149 hsa-miR-495 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004656 Function Procollagen-proline 4-dioxygenase activity IBA 21873635
GO:0005506 Function Iron ion binding IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005783 Component Endoplasmic reticulum IBA 21873635
GO:0005783 Component Endoplasmic reticulum IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600608 8547 ENSG00000072682
Protein
UniProt ID O15460
Protein name Prolyl 4-hydroxylase subunit alpha-2 (4-PH alpha-2) (EC 1.14.11.2) (Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2)
Protein function Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
PDB 6EVL , 6EVM , 6EVN , 6EVO , 6EVP , 7ZSC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08336 P4Ha_N 26 157 Prolyl 4-Hydroxylase alpha-subunit, N-terminal region Family
PF13640 2OG-FeII_Oxy_3 416 519 2OG-Fe(II) oxygenase superfamily Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the heart, placenta, lung and pancreas. {ECO:0000269|PubMed:9211872}.
Sequence
MKLWVSALLMAWFGVLSCVQAEFFTSIGHMTDLIYAEKELVQSLKEYILVEEAKLSKIKS
WANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTDWPALEDLVLQDSAAGFIANLSVQR
QFFPTDEDEIGAAKALMRLQDTYRLDPGTISRGELPG
TKYQAMLSVDDCFGMGRSAYNEG
DYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSH
ERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVK
LTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPK
LARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVAN
YGVGGQYEPHFDFSRNDERDTFKHLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKK
GTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNKWFH
ERGQEFLRPCGSTEVD
Sequence length 535
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Arginine and proline metabolism
Metabolic pathways
  Collagen biosynthesis and modifying enzymes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Hypertension Hypertensive disease rs13306026 19609347
Myopia Severe myopia, MYOPIA 25, AUTOSOMAL DOMINANT rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805
View all (6 more)
25741866
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease 17804789 ClinVar
Rheumatoid arthritis Rheumatoid arthritis GWAS
Giant Cell Arteritis Giant Cell Arteritis GWAS
Gout Gout GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 36403427
Angiofibroma Associate 27633981
Carcinoma Ductal Breast Associate 30410060, 35076865
Carcinoma Hepatocellular Associate 33215860, 37248456
Carcinoma Intraductal Noninfiltrating Associate 30410060, 35076865
Colorectal Neoplasms Associate 38522060
Esophageal Squamous Cell Carcinoma Associate 26330293
Giant Cell Arteritis Associate 28041642
Glioblastoma Associate 20504876, 35111402
Hypoxia Associate 23423382, 26059435