Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8973
Gene name Gene Name - the full gene name approved by the HGNC.	Cholinergic receptor nicotinic alpha 6 subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CHRNA6
Synonyms (NCBI Gene) Gene synonyms aliases	CHNRA6
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an alpha subunit of neuronal nicotinic acetylcholine receptors. These receptors consist of five subunits and function as ion channels involved in neurotransmission. The encoded protein is a subunit of neuronal nicotinic acetylcholine rec

Show/Hide all(30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT450394	hsa-miR-648	PAR-CLIP	22100165
MIRT450393	hsa-miR-644a	PAR-CLIP	22100165
MIRT450392	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT450391	hsa-miR-4474-3p	PAR-CLIP	22100165
MIRT450390	hsa-miR-3591-5p	PAR-CLIP	22100165
MIRT450394	hsa-miR-648	PAR-CLIP	22100165
MIRT450393	hsa-miR-644a	PAR-CLIP	22100165
MIRT450392	hsa-miR-142-3p	PAR-CLIP	22100165
MIRT450391	hsa-miR-4474-3p	PAR-CLIP	22100165
MIRT450390	hsa-miR-3591-5p	PAR-CLIP	22100165
MIRT891877	hsa-miR-200b	CLIP-seq
MIRT891878	hsa-miR-200c	CLIP-seq
MIRT891879	hsa-miR-3622a-3p	CLIP-seq
MIRT891880	hsa-miR-3622b-3p	CLIP-seq
MIRT891881	hsa-miR-369-3p	CLIP-seq
MIRT891882	hsa-miR-429	CLIP-seq
MIRT891883	hsa-miR-4717-3p	CLIP-seq
MIRT891884	hsa-miR-1229	CLIP-seq
MIRT891885	hsa-miR-1914	CLIP-seq
MIRT891886	hsa-miR-4713-5p	CLIP-seq
MIRT2200451	hsa-miR-323-3p	CLIP-seq
MIRT2200452	hsa-miR-4797-5p	CLIP-seq
MIRT2503248	hsa-miR-155	CLIP-seq
MIRT2503249	hsa-miR-3150b-3p	CLIP-seq
MIRT2503250	hsa-miR-4424	CLIP-seq
MIRT2503251	hsa-miR-4663	CLIP-seq
MIRT2503252	hsa-miR-4689	CLIP-seq
MIRT2503253	hsa-miR-4728-3p	CLIP-seq
MIRT2503254	hsa-miR-4779	CLIP-seq
MIRT2503255	hsa-miR-4784	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	27344019
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005892	Component	Acetylcholine-gated channel complex	TAS	8906617
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007271	Process	Synaptic transmission, cholinergic	IEA
GO:0015464	Function	Acetylcholine receptor activity	TAS	8906617
GO:0022848	Function	Acetylcholine-gated cation-selective channel activity	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0034220	Process	Ion transmembrane transport	IBA	21873635
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0045202	Component	Synapse	IBA	21873635
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050877	Process	Nervous system process	IBA	21873635
GO:0060079	Process	Excitatory postsynaptic potential	IEA

MIM	HGNC	e!Ensembl
606888	15963	ENSG00000147434

Protein

UniProt ID

Q15825

Protein name

Neuronal acetylcholine receptor subunit alpha-6

Protein function

Component of neuronal acetylcholine receptors (nAChRs) that function as pentameric, ligand-gated cation channels with high calcium permeability among other activities. nAChRs are excitatory neurotrasnmitter receptors formed by a collection of nA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	34 → 240	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	247 → 483	Neurotransmitter-gated ion-channel transmembrane region	Family

Sequence

MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTA
GLFLQPLLGNTGKS

Sequence length

494

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Cholinergic synapse Nicotine addiction		Highly calcium permeable postsynaptic nicotinic acetylcholine receptors Highly calcium permeable nicotinic acetylcholine receptors

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder		19204725	ClinVar

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	34887858
Antisocial Personality Disorder	Associate	27085880
Attention Deficit Disorder with Hyperactivity	Associate	23899432
Bipolar Disorder	Associate	24675634
Breast Neoplasms	Associate	38291367
Carcinoma Renal Cell	Associate	24479813
Chondrosarcoma Extraskeletal Myxoid	Stimulate	38447752
Cocaine Related Disorders	Associate	24675634
Lung Neoplasms	Associate	25233467
Substance Related Disorders	Associate	27085880
Tobacco Use Disorder	Associate	19500157, 20584212

CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit)