Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	896
Gene name	Cyclin D3
Gene symbol	CCND3
Synonyms (NCBI Gene)	-
Chromosome	6
Chromosome location	6p21.1
Summary	The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit

181

Show/Hide all (181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001010	hsa-miR-34a-5p	Western blot	18406353
MIRT000940	hsa-miR-16-5p	qRT-PCRflowLuciferase reporter assayWestern blot	18701644
MIRT000937	hsa-miR-424-5p	qRT-PCRflowLuciferase reporter assayWestern blot	18701644
MIRT000937	hsa-miR-424-5p	qRT-PCRflowWestern blot	18701644
MIRT000940	hsa-miR-16-5p	qRT-PCRflowWestern blot	18701644
MIRT000940	hsa-miR-16-5p	Luciferase reporter assay	18701644
MIRT006246	hsa-miR-195-5p	Luciferase reporter assayWestern blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT006246	hsa-miR-195-5p	Luciferase reporter assayWestern blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT006246	hsa-miR-195-5p	Luciferase reporter assayWestern blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assayqRT-PCRWestern blot	22362728
MIRT052181	hsa-let-7b-5p	CLASH	23622248
MIRT046238	hsa-miR-27b-3p	CLASH	23622248
MIRT043067	hsa-miR-324-5p	CLASH	23622248
MIRT039712	hsa-miR-615-3p	CLASH	23622248
MIRT039712	hsa-miR-615-3p	CLASH	23622248
MIRT006299	hsa-miR-138-5p	ImmunoblotLuciferase reporter assayqRT-PCR	23208504
MIRT006299	hsa-miR-138-5p	ImmunoblotLuciferase reporter assayqRT-PCR	23208504
MIRT053075	hsa-miR-503-5p	FlowqRT-PCRWestern blot	23967867
MIRT006246	hsa-miR-195-5p	Luciferase reporter assayWestern blot	23544130
MIRT437796	hsa-miR-497-5p	Luciferase reporter assayWestern blot	23544130
MIRT006299	hsa-miR-138-5p	qRT-PCR	25439221
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT440984	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440984	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT006299	hsa-miR-138-5p	Western blot	26823826
MIRT732667	hsa-miR-34a-3p	Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	34056735
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT871733	hsa-miR-1226	CLIP-seq
MIRT871734	hsa-miR-1301	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT871736	hsa-miR-15a	CLIP-seq
MIRT871737	hsa-miR-15b	CLIP-seq
MIRT871738	hsa-miR-16	CLIP-seq
MIRT871739	hsa-miR-195	CLIP-seq
MIRT871740	hsa-miR-214	CLIP-seq
MIRT871741	hsa-miR-3200-3p	CLIP-seq
MIRT871742	hsa-miR-3614-3p	CLIP-seq
MIRT871743	hsa-miR-3619-5p	CLIP-seq
MIRT871744	hsa-miR-3662	CLIP-seq
MIRT871745	hsa-miR-3679-3p	CLIP-seq
MIRT871746	hsa-miR-3938	CLIP-seq
MIRT871747	hsa-miR-424	CLIP-seq
MIRT871748	hsa-miR-4291	CLIP-seq
MIRT871749	hsa-miR-4305	CLIP-seq
MIRT871750	hsa-miR-4496	CLIP-seq
MIRT871751	hsa-miR-4640-5p	CLIP-seq
MIRT871752	hsa-miR-4726-5p	CLIP-seq
MIRT871753	hsa-miR-497	CLIP-seq
MIRT871754	hsa-miR-5047	CLIP-seq
MIRT871755	hsa-miR-545	CLIP-seq
MIRT871756	hsa-miR-761	CLIP-seq
MIRT871757	hsa-miR-922	CLIP-seq
MIRT871758	hsa-miR-101	CLIP-seq
MIRT871759	hsa-miR-1207-5p	CLIP-seq
MIRT871760	hsa-miR-1265	CLIP-seq
MIRT871761	hsa-miR-1293	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT871762	hsa-miR-144	CLIP-seq
MIRT871763	hsa-miR-1827	CLIP-seq
MIRT871764	hsa-miR-2392	CLIP-seq
MIRT871765	hsa-miR-3612	CLIP-seq
MIRT871766	hsa-miR-3689d	CLIP-seq
MIRT871767	hsa-miR-4254	CLIP-seq
MIRT871768	hsa-miR-4328	CLIP-seq
MIRT871769	hsa-miR-4443	CLIP-seq
MIRT871770	hsa-miR-4483	CLIP-seq
MIRT871751	hsa-miR-4640-5p	CLIP-seq
MIRT871752	hsa-miR-4726-5p	CLIP-seq
MIRT871771	hsa-miR-4763-3p	CLIP-seq
MIRT871772	hsa-miR-513b	CLIP-seq
MIRT871773	hsa-miR-556-3p	CLIP-seq
MIRT871774	hsa-miR-582-5p	CLIP-seq
MIRT871775	hsa-miR-650	CLIP-seq
MIRT871776	hsa-miR-885-3p	CLIP-seq
MIRT871777	hsa-miR-940	CLIP-seq
MIRT871736	hsa-miR-15a	CLIP-seq
MIRT871737	hsa-miR-15b	CLIP-seq
MIRT871738	hsa-miR-16	CLIP-seq
MIRT871739	hsa-miR-195	CLIP-seq
MIRT871744	hsa-miR-3662	CLIP-seq
MIRT871747	hsa-miR-424	CLIP-seq
MIRT1958728	hsa-miR-4701-5p	CLIP-seq
MIRT871753	hsa-miR-497	CLIP-seq
MIRT1958729	hsa-miR-588	CLIP-seq
MIRT871759	hsa-miR-1207-5p	CLIP-seq
MIRT2195442	hsa-miR-1245b-3p	CLIP-seq
MIRT2195443	hsa-miR-1273g	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT2195444	hsa-miR-138	CLIP-seq
MIRT871763	hsa-miR-1827	CLIP-seq
MIRT2195445	hsa-miR-218	CLIP-seq
MIRT2195446	hsa-miR-3120-3p	CLIP-seq
MIRT2195447	hsa-miR-330-3p	CLIP-seq
MIRT871765	hsa-miR-3612	CLIP-seq
MIRT2195448	hsa-miR-3690	CLIP-seq
MIRT2195449	hsa-miR-382	CLIP-seq
MIRT2195450	hsa-miR-3909	CLIP-seq
MIRT2195451	hsa-miR-409-5p	CLIP-seq
MIRT871767	hsa-miR-4254	CLIP-seq
MIRT2195452	hsa-miR-4265	CLIP-seq
MIRT2195453	hsa-miR-4296	CLIP-seq
MIRT2195454	hsa-miR-4322	CLIP-seq
MIRT2195455	hsa-miR-4435	CLIP-seq
MIRT871769	hsa-miR-4443	CLIP-seq
MIRT2195456	hsa-miR-4484	CLIP-seq
MIRT2195457	hsa-miR-4648	CLIP-seq
MIRT2195458	hsa-miR-4654	CLIP-seq
MIRT2195459	hsa-miR-4733-3p	CLIP-seq
MIRT871771	hsa-miR-4763-3p	CLIP-seq
MIRT2195460	hsa-miR-4769-5p	CLIP-seq
MIRT2195461	hsa-miR-524-3p	CLIP-seq
MIRT2195462	hsa-miR-525-3p	CLIP-seq
MIRT2195463	hsa-miR-561	CLIP-seq
MIRT871775	hsa-miR-650	CLIP-seq
MIRT871777	hsa-miR-940	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
ATF5	Activation	16300731
ETV4	Activation	17467662
NR3C1	Repression	9154817
STAT3	Activation	15184887

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	7603984, 8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	33854239
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	8114739
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	9106657, 9311810, 11896535, 14641107, 15232106, 16189514, 16721056, 17517622, 19237555, 21516116, 21988832, 23455922, 23602568, 25241761, 25416956, 25910212, 26496610, 27107012, 28514442, 29997244, 30833792, 31515488, 32296183, 32707033, 32814053, 33961781, 34591612, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	8114739
GO:0042098	Process	T cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	8114739
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IDA	8114739
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	TAS	33854239
GO:0097130	Component	Cyclin D3-CDK4 complex	IPI	19237555
GO:0097133	Component	Cyclin D3-CDK6 complex	IPI	8114739
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IBA

MIM	HGNC	e!Ensembl
123834	1585	ENSG00000112576

P30281

Protein name

G1/S-specific cyclin-D3

Protein function

Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition (PubMed:8114739). Phosphorylation of R

PDB

3G33 , 7SJ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	26 → 153	Cyclin, N-terminal domain	Domain
PF02984	Cyclin_C	155 → 279	Cyclin, C-terminal domain	Domain

Sequence

MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Sequence length

292

Interactions

View interactions

CCND3 (cyclin D3)