Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	896
Gene name Gene Name - the full gene name approved by the HGNC.	Cyclin D3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCND3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit

Show/Hide all(181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001010	hsa-miR-34a-5p	Western blot	18406353
MIRT000940	hsa-miR-16-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT000937	hsa-miR-424-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT000937	hsa-miR-424-5p	qRT-PCR, flow, Western blot	18701644
MIRT000940	hsa-miR-16-5p	qRT-PCR, flow, Western blot	18701644
MIRT000940	hsa-miR-16-5p	Luciferase reporter assay	18701644
MIRT006246	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006246	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006246	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT006299	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	22362728
MIRT052181	hsa-let-7b-5p	CLASH	23622248
MIRT046238	hsa-miR-27b-3p	CLASH	23622248
MIRT043067	hsa-miR-324-5p	CLASH	23622248
MIRT039712	hsa-miR-615-3p	CLASH	23622248
MIRT039712	hsa-miR-615-3p	CLASH	23622248
MIRT006299	hsa-miR-138-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23208504
MIRT006299	hsa-miR-138-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	23208504
MIRT053075	hsa-miR-503-5p	Flow, qRT-PCR, Western blot	23967867
MIRT006246	hsa-miR-195-5p	Luciferase reporter assay, Western blot	23544130
MIRT437796	hsa-miR-497-5p	Luciferase reporter assay, Western blot	23544130
MIRT006299	hsa-miR-138-5p	qRT-PCR	25439221
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT440984	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440984	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT006299	hsa-miR-138-5p	Western blot	26823826
MIRT732667	hsa-miR-34a-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34056735
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT317835	hsa-miR-28-5p	PAR-CLIP	22100165
MIRT317839	hsa-miR-3139	PAR-CLIP	22100165
MIRT317837	hsa-miR-708-5p	PAR-CLIP	22100165
MIRT445770	hsa-miR-1321	PAR-CLIP	22100165
MIRT445769	hsa-miR-4739	PAR-CLIP	22100165
MIRT445768	hsa-miR-4756-5p	PAR-CLIP	22100165
MIRT445767	hsa-miR-4270	PAR-CLIP	22100165
MIRT445766	hsa-miR-4441	PAR-CLIP	22100165
MIRT445765	hsa-miR-6754-5p	PAR-CLIP	22100165
MIRT445764	hsa-miR-6132	PAR-CLIP	22100165
MIRT445762	hsa-miR-6836-5p	PAR-CLIP	22100165
MIRT445763	hsa-miR-1909-3p	PAR-CLIP	22100165
MIRT445760	hsa-miR-6722-3p	PAR-CLIP	22100165
MIRT445761	hsa-miR-765	PAR-CLIP	22100165
MIRT445758	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT871733	hsa-miR-1226	CLIP-seq
MIRT871734	hsa-miR-1301	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT871736	hsa-miR-15a	CLIP-seq
MIRT871737	hsa-miR-15b	CLIP-seq
MIRT871738	hsa-miR-16	CLIP-seq
MIRT871739	hsa-miR-195	CLIP-seq
MIRT871740	hsa-miR-214	CLIP-seq
MIRT871741	hsa-miR-3200-3p	CLIP-seq
MIRT871742	hsa-miR-3614-3p	CLIP-seq
MIRT871743	hsa-miR-3619-5p	CLIP-seq
MIRT871744	hsa-miR-3662	CLIP-seq
MIRT871745	hsa-miR-3679-3p	CLIP-seq
MIRT871746	hsa-miR-3938	CLIP-seq
MIRT871747	hsa-miR-424	CLIP-seq
MIRT871748	hsa-miR-4291	CLIP-seq
MIRT871749	hsa-miR-4305	CLIP-seq
MIRT871750	hsa-miR-4496	CLIP-seq
MIRT871751	hsa-miR-4640-5p	CLIP-seq
MIRT871752	hsa-miR-4726-5p	CLIP-seq
MIRT871753	hsa-miR-497	CLIP-seq
MIRT871754	hsa-miR-5047	CLIP-seq
MIRT871755	hsa-miR-545	CLIP-seq
MIRT871756	hsa-miR-761	CLIP-seq
MIRT871757	hsa-miR-922	CLIP-seq
MIRT871758	hsa-miR-101	CLIP-seq
MIRT871759	hsa-miR-1207-5p	CLIP-seq
MIRT871760	hsa-miR-1265	CLIP-seq
MIRT871761	hsa-miR-1293	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT871762	hsa-miR-144	CLIP-seq
MIRT871763	hsa-miR-1827	CLIP-seq
MIRT871764	hsa-miR-2392	CLIP-seq
MIRT871765	hsa-miR-3612	CLIP-seq
MIRT871766	hsa-miR-3689d	CLIP-seq
MIRT871767	hsa-miR-4254	CLIP-seq
MIRT871768	hsa-miR-4328	CLIP-seq
MIRT871769	hsa-miR-4443	CLIP-seq
MIRT871770	hsa-miR-4483	CLIP-seq
MIRT871751	hsa-miR-4640-5p	CLIP-seq
MIRT871752	hsa-miR-4726-5p	CLIP-seq
MIRT871771	hsa-miR-4763-3p	CLIP-seq
MIRT871772	hsa-miR-513b	CLIP-seq
MIRT871773	hsa-miR-556-3p	CLIP-seq
MIRT871774	hsa-miR-582-5p	CLIP-seq
MIRT871775	hsa-miR-650	CLIP-seq
MIRT871776	hsa-miR-885-3p	CLIP-seq
MIRT871777	hsa-miR-940	CLIP-seq
MIRT871736	hsa-miR-15a	CLIP-seq
MIRT871737	hsa-miR-15b	CLIP-seq
MIRT871738	hsa-miR-16	CLIP-seq
MIRT871739	hsa-miR-195	CLIP-seq
MIRT871744	hsa-miR-3662	CLIP-seq
MIRT871747	hsa-miR-424	CLIP-seq
MIRT1958728	hsa-miR-4701-5p	CLIP-seq
MIRT871753	hsa-miR-497	CLIP-seq
MIRT1958729	hsa-miR-588	CLIP-seq
MIRT871759	hsa-miR-1207-5p	CLIP-seq
MIRT2195442	hsa-miR-1245b-3p	CLIP-seq
MIRT2195443	hsa-miR-1273g	CLIP-seq
MIRT871735	hsa-miR-1343	CLIP-seq
MIRT2195444	hsa-miR-138	CLIP-seq
MIRT871763	hsa-miR-1827	CLIP-seq
MIRT2195445	hsa-miR-218	CLIP-seq
MIRT2195446	hsa-miR-3120-3p	CLIP-seq
MIRT2195447	hsa-miR-330-3p	CLIP-seq
MIRT871765	hsa-miR-3612	CLIP-seq
MIRT2195448	hsa-miR-3690	CLIP-seq
MIRT2195449	hsa-miR-382	CLIP-seq
MIRT2195450	hsa-miR-3909	CLIP-seq
MIRT2195451	hsa-miR-409-5p	CLIP-seq
MIRT871767	hsa-miR-4254	CLIP-seq
MIRT2195452	hsa-miR-4265	CLIP-seq
MIRT2195453	hsa-miR-4296	CLIP-seq
MIRT2195454	hsa-miR-4322	CLIP-seq
MIRT2195455	hsa-miR-4435	CLIP-seq
MIRT871769	hsa-miR-4443	CLIP-seq
MIRT2195456	hsa-miR-4484	CLIP-seq
MIRT2195457	hsa-miR-4648	CLIP-seq
MIRT2195458	hsa-miR-4654	CLIP-seq
MIRT2195459	hsa-miR-4733-3p	CLIP-seq
MIRT871771	hsa-miR-4763-3p	CLIP-seq
MIRT2195460	hsa-miR-4769-5p	CLIP-seq
MIRT2195461	hsa-miR-524-3p	CLIP-seq
MIRT2195462	hsa-miR-525-3p	CLIP-seq
MIRT2195463	hsa-miR-561	CLIP-seq
MIRT871775	hsa-miR-650	CLIP-seq
MIRT871777	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
ATF5	Activation	16300731
ETV4	Activation	17467662
NR3C1	Repression	9154817
STAT3	Activation	15184887

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	7603984, 8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	33854239
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	8114739
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	9106657, 9311810, 11896535, 14641107, 15232106, 16189514, 16721056, 17517622, 19237555, 21516116, 21988832, 23455922, 23602568, 25241761, 25416956, 25910212, 26496610, 27107012, 28514442, 29997244, 30833792, 31515488, 32296183, 32707033, 32814053, 33961781, 34591612, 35512704
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	8114739
GO:0042098	Process	T cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	8114739
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IDA	8114739
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	TAS	33854239
GO:0097130	Component	Cyclin D3-CDK4 complex	IPI	19237555
GO:0097133	Component	Cyclin D3-CDK6 complex	IPI	8114739
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IBA

MIM	HGNC	e!Ensembl
123834	1585	ENSG00000112576

Protein

UniProt ID

P30281

Protein name

G1/S-specific cyclin-D3

Protein function

Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition (PubMed:8114739). Phosphorylation of R

PDB

3G33 , 7SJ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00134	Cyclin_N	26 → 153	Cyclin, N-terminal domain	Domain
PF02984	Cyclin_C	155 → 279	Cyclin, C-terminal domain	Domain

Sequence

MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Sequence length

292

Interactions

View interactions

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (70)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma Follicular	Associate	16798934
Ataxia Telangiectasia	Associate	11457838
Bone Neoplasms	Associate	23199169
Breast Neoplasms	Associate	15569667, 18507837, 19242061, 20003265, 25927147, 29562954, 38198023, 9528753
Burkitt Lymphoma	Associate	22885699, 28209658, 31849147, 32449435, 33020271, 34472720, 36201743, 37053555
Calcinosis Cutis	Stimulate	15980885
Carcinogenesis	Associate	11418483
Carcinoma Hepatocellular	Associate	23082062
Carcinoma Non Small Cell Lung	Associate	20631637, 26201895
Carcinoma Pancreatic Ductal	Associate	20113529, 31381571
Cardiomyopathy infantile histiocytoid	Associate	19787802
Cholangiocarcinoma	Associate	35792239
Colonic Neoplasms	Associate	16012517, 19542220
Colorectal Neoplasms	Associate	15980885
Death	Associate	18507837
Diabetes Mellitus Type 2	Associate	27380896, 28812028
Endometrial Neoplasms	Associate	16884382
Feeding and Eating Disorders	Associate	34579086
Fibrosarcoma	Associate	8816437
GATA2 Deficiency	Associate	20062012
Glioblastoma	Stimulate	10416984
Glioblastoma	Associate	22217655
Glioma	Associate	10416984, 30548945
Gliosarcoma	Associate	10416984
Hashimoto Disease	Associate	12890807
Hemangiopericytoma	Associate	18459177
Hepatoblastoma	Associate	32871763
Hodgkin Disease	Associate	20062012
Hyperimmunoglobulin G1(A1) Syndrome	Stimulate	20496072
Hyperplasia	Associate	16445666
Immune System Diseases	Associate	35687490
Infections	Associate	10933691
Leukemia Lymphocytic Chronic B Cell	Associate	11675358, 12393642, 12644019, 15096562
Leukemia Myeloid Acute	Associate	20062012, 30381403, 34103301
Leukemia Prolymphocytic T Cell	Associate	26003188
Lymphoma	Associate	20062012, 25839159, 33399078, 35687490
Lymphoma B Cell	Associate	10397744, 11675358, 15665120, 28209658, 31849147, 36221796
Lymphoma B Cell Marginal Zone	Associate	37941429
Lymphoma Follicular	Associate	27959929
Lymphoma Large B Cell Diffuse	Associate	11675358, 20062012, 22885699, 31849147, 35687490
Lymphoma Mantle Cell	Associate	15096562, 18391076, 20062012, 27123851, 30538135, 9376597
Lymphoma T Cell	Associate	24345752
Lymphoma T Cell Cutaneous	Associate	16614728
Melanoma	Associate	11253137, 16815849, 20496072
Migraine Disorders	Associate	28801450
Multiple Myeloma	Associate	11418483, 14531906, 16728703, 17914559, 19446321, 20093236, 24638926
Muscle Neoplasms	Stimulate	20174823
Myoclonic dystonia	Associate	18391076
Myotonic Dystrophy	Associate	40156865
Nasopharyngeal Carcinoma	Associate	29367693
Neoplasm Metastasis	Stimulate	11253137
Neoplasm Metastasis	Associate	15980885
Neoplasms	Associate	10397744, 16123218, 16798934, 17517622, 18381641, 19787802, 20174823, 23583282, 25300797, 25578962, 26201895, 26491227, 28481029, 31302234, 36853016, 37000627, 8816437 View all (2 more)
Neoplasms	Inhibit	16012517
Neuroblastoma	Associate	14500366, 33456359
Non Muscle Invasive Bladder Neoplasms	Stimulate	20174823
Osteosarcoma	Associate	25300797, 25418192
Ovarian Neoplasms	Associate	19738611
Pancreatic Neoplasms	Associate	11469683
Paraproteinemias	Associate	19996118
Parkinson Disease	Associate	25182869
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20062012, 27750045, 28671688
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	15667533, 34396983
Prostatic Neoplasms	Associate	33522043
Salivary Duct Calculi	Associate	23583282
Soft Tissue Neoplasms	Associate	18019405
Stomach Neoplasms	Associate	19210573
Thyroid cancer Hurthle cell	Associate	19787802
Thyroid Neoplasms	Associate	10510327
Urinary Bladder Neoplasms	Associate	19762144

CCND3 (cyclin D3)