TOP3B (DNA topoisomerase III beta)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8940
Gene name Gene Name - the full gene name approved by the HGNC.
DNA topoisomerase III beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TOP3B
Synonyms (NCBI Gene) Gene synonyms aliases
TOP3B1
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q11.22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one a
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT1447331 hsa-miR-1184 CLIP-seq
MIRT1447332 hsa-miR-183 CLIP-seq
MIRT1447333 hsa-miR-346 CLIP-seq
MIRT1447334 hsa-miR-4288 CLIP-seq
MIRT1447335 hsa-miR-4418 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0000793 Component Condensed chromosome IEA
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003916 Function DNA topoisomerase activity IBA 21873635
GO:0003917 Function DNA topoisomerase type I (single strand cut, ATP-independent) activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603582 11993 ENSG00000100038
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95985
Protein name DNA topoisomerase 3-beta-1 (EC 5.6.2.1) (DNA topoisomerase III beta-1)
Protein function Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a targ
PDB 5GVC , 5GVE , 9C9W , 9C9Y , 9CA0 , 9CA1 , 9CA4 , 9CAG , 9CAH , 9CAJ , 9CAK , 9CAL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01751 Toprim 4 → 155 Toprim domain Family
PF01131 Topoisom_bac 169 → 583 DNA topoisomerase Family
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is found in testis, heart and skeletal muscle. A 4 kb transcript which probably represents isoform 2 is found in thymus, kidney and pancreas. {ECO:0000269|PubMed:9927731}.
Sequence 
MKTVLMVAEKPSLAQSIAKILSRGSLSSHKGLNGACSVHEYTGTFAGQPVRFKMTSVCGH
VMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYIVLWLDCDK
EGENICFEVLDAVLPVMNKAHGGEKTVFRARFSSITDTDICNAMACLGEPDHNEALSVDA
RQELDLRIGCAFTRFQTKYFQGKYGDLDSSLISFGPCQTPTLGFCVERHDKIQSFKPETY
WVLQAKVNTDKDRSLLLDWDRVRVFDREIAQMFLNMTKLEKEAQVEATSRKEKAKQRPLA
LNTVEMLRVASSSLGMGPQHAMQTAERLYTQGYISYPRTETTHYPENFDLKGSLRQQANH
PYWADTVKRLLAEGINRPRKGHDAGDHPPITPMKSATEAELGGDAWRLYEYITRHFIATV
SHDCKYLQSTISFRIGPELFTCSGKTVLSPGFTEVMPWQSVPLEESLPTCQRGDAFPVGE
VKMLEKQTNPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYVTVESGRRLKPTNL
GIVLVHGYYKIDAELVLPTIRSAVEKQLNLIAQGKADYRQVLGHTLDVFKRKFHYFVDSI
AGMDELMEVSFSPLAATGKPLSRCGKCHRFMKYIQAKPSRLHCSHCDETYTLPQNGTIKL
YKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSM
LGIGQCVECESGVLVLDPTSGPKWKVACNKCNVVAHCFENAHRVRVSADTCSVCEAALLD
VDFNKAKSPLPGDETQHMGCVFCDPVFQELVELKHAASCHPMHRGGPGRRQGRGRGRARR
PPGKPNPRRPKDKMSALAAYFV
Sequence length 862
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Homologous recombination
Fanconi anemia pathway 		 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 23912948
Show/Hide Text Mining Associations (16)
Associations from Text Mining
Disease Name Relationship Type References
Autistic Disorder Associate 27880953
Carcinoma Ovarian Epithelial Associate 27315793
Cleft Palate Associate 31204702
Cognition Disorders Associate 23912948, 27880953, 31204702
Congenital Abnormalities Associate 27880953
Developmental Disabilities Associate 23912948
DiGeorge Syndrome Associate 31204702
Facial Dysmorphism with Multiple Malformations Associate 27880953
Fragile X Syndrome Associate 23912948, 27880953
Heart Defects Congenital Associate 25376777