Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8935
Gene name Gene Name - the full gene name approved by the HGNC.
Src kinase associated phosphoprotein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SKAP2
Synonyms (NCBI Gene) Gene synonyms aliases
PRAP, RA70, SAPS, SCAP2, SKAP-HOM, SKAP55R
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating prop
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003875 hsa-miR-15a-5p Microarray, qRT-PCR 18362358
MIRT004369 hsa-miR-16-5p Microarray, qRT-PCR 18362358
MIRT017252 hsa-miR-335-5p Microarray 18185580
MIRT042017 hsa-miR-484 CLASH 23622248
MIRT666349 hsa-miR-3664-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21719704
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005829 Component Cytosol IDA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605215 15687 ENSG00000005020
Protein
UniProt ID O75563
Protein name Src kinase-associated phosphoprotein 2 (Pyk2/RAFTK-associated protein) (Retinoic acid-induced protein 70) (SKAP55 homolog) (SKAP-55HOM) (SKAP-HOM) (Src family-associated phosphoprotein 2) (Src kinase-associated phosphoprotein 55-related protein) (Src-asso
Protein function May be involved in B-cell and macrophage adhesion processes. In B-cells, may act by coupling the B-cell receptor (BCR) to integrin activation. May play a role in src signaling pathway.
PDB 3OMH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 117 219 PH domain Domain
PF00018 SH3_1 305 350 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Present in platelets (at protein level). {ECO:0000269|PubMed:10942756, ECO:0000269|PubMed:9755858, ECO:0000269|PubMed:9837776}.
Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYL
QEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKD
GKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQ
DMESDIIPEDYDERGELYDDV
DHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYAN
FYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Sequence length 359
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Yersinia infection   Signal regulatory protein family interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
19430480
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 26192919
Multiple sclerosis Multiple Sclerosis rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)
22190364, 24076602
Psoriasis Psoriasis rs281875215, rs587777763, rs281875213, rs281875212 26974007
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease 26974007, 23128233, 26192919 ClinVar
Crohn Disease Crohn Disease GWAS
Multiple Sclerosis Multiple Sclerosis GWAS
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Associations from Text Mining
Disease Name Relationship Type References
Autoimmune Diseases Associate 34172489, 34989154
Carcinoma Pancreatic Ductal Associate 17952125
Diabetes Mellitus Associate 34172489
Diabetes Mellitus Type 1 Associate 21270831, 31455420, 34172489, 34556755, 34989154, 36150053
Leukemia Myeloid Acute Associate 32398790
Melanoma Associate 20520718
Multiple Chronic Conditions Associate 34172489
Osteoarthritis Associate 31523167
Osteomyelitis Associate 37433170
Schizophrenia Associate 33350444