Gene Gene information from NCBI Gene database.
Entrez ID 8935
Gene name Src kinase associated phosphoprotein 2
Gene symbol SKAP2
Synonyms (NCBI Gene)
PRAPRA70SAPSSCAP2SKAP-HOMSKAP55R
Chromosome 7
Chromosome location 7p15.2
Summary The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating prop
miRNA miRNA information provided by mirtarbase database.
434
miRTarBase ID miRNA Experiments Reference
MIRT003875 hsa-miR-15a-5p MicroarrayqRT-PCR 18362358
MIRT004369 hsa-miR-16-5p MicroarrayqRT-PCR 18362358
MIRT017252 hsa-miR-335-5p Microarray 18185580
MIRT042017 hsa-miR-484 CLASH 23622248
MIRT666349 hsa-miR-3664-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21719704, 27956147
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605215 15687 ENSG00000005020
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75563
Protein name Src kinase-associated phosphoprotein 2 (Pyk2/RAFTK-associated protein) (Retinoic acid-induced protein 70) (SKAP55 homolog) (SKAP-55HOM) (SKAP-HOM) (Src family-associated phosphoprotein 2) (Src kinase-associated phosphoprotein 55-related protein) (Src-asso
Protein function May be involved in B-cell and macrophage adhesion processes. In B-cells, may act by coupling the B-cell receptor (BCR) to integrin activation. May play a role in src signaling pathway.
PDB 3OMH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 117 219 PH domain Domain
PF00018 SH3_1 305 350 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Present in platelets (at protein level). {ECO:0000269|PubMed:10942756, ECO:0000269|PubMed:9755858, ECO:0000269|PubMed:9837776}.
Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYL
QEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKD
GKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQ
DMESDIIPEDYDERGELYDDV
DHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYAN
FYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Sequence length 359
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Yersinia infection   Signal regulatory protein family interactions